Protein Info for CA265_RS04845 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 409 transmembrane" amino acids 7 to 23 (17 residues), see Phobius details amino acids 48 to 70 (23 residues), see Phobius details amino acids 77 to 97 (21 residues), see Phobius details amino acids 103 to 125 (23 residues), see Phobius details amino acids 136 to 158 (23 residues), see Phobius details amino acids 165 to 185 (21 residues), see Phobius details amino acids 205 to 227 (23 residues), see Phobius details amino acids 255 to 277 (23 residues), see Phobius details amino acids 289 to 306 (18 residues), see Phobius details amino acids 312 to 329 (18 residues), see Phobius details amino acids 349 to 369 (21 residues), see Phobius details amino acids 381 to 399 (19 residues), see Phobius details PF07690: MFS_1" amino acids 14 to 363 (350 residues), 170.3 bits, see alignment E=2.9e-54

Best Hits

KEGG orthology group: None (inferred from 80% identity to phe:Phep_3254)

Predicted SEED Role

"Major facilitator family transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z1C9 at UniProt or InterPro

Protein Sequence (409 amino acids)

>CA265_RS04845 MFS transporter (Pedobacter sp. GW460-11-11-14-LB5)
MREKRYAWVVVGLLWFVALLNYMDRQMLSTMKPAMQMDIAELKSATNFGYLMAIFLWIYG
LMSPVSGIIADKLNRKWLIVGSLMVWSLVTFLMGYATTFNQIYWLRALMGVSEALYIPAG
LSLIADYHSSKTRSVAIGIHMTGLYMGQALGGFGATIASKFSWQATFHSFGFVGIVYALI
LMFFLREKKHTEIQGTETIRIKQPLFKGLALLFSNISFWVILIYFAIPSLPGWATKNWLP
TLFANNLGIDMAQAGPISTITIAASSFLGVIFGGILSDRWVQKNIKGRIYTSAIGLGLTI
PSLLLIGFGHSLFNIIGAAFCFGFGYGMFDANNMPILCQFVSSKSRATAYGVMNMTGVFA
GAFITDLLGKSTDSGSLGKDFAMLSIIVFIALMIQLYFLRPKFNDFEDA