Protein Info for CA265_RS04420 in Pedobacter sp. GW460-11-11-14-LB5
Annotation: 2-amino-4-hydroxy-6- hydroxymethyldihydropteridine diphosphokinase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 40% identical to HPPK_HAEIN: 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (folK) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
KEGG orthology group: K00950, 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC: 2.7.6.3] (inferred from 56% identity to phe:Phep_3073)Predicted SEED Role
"2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC 2.7.6.3)" in subsystem Folate Biosynthesis (EC 2.7.6.3)
MetaCyc Pathways
- superpathway of tetrahydrofolate biosynthesis and salvage (10/12 steps found)
- superpathway of tetrahydrofolate biosynthesis (8/10 steps found)
- 6-hydroxymethyl-dihydropterin diphosphate biosynthesis IV (Plasmodium) (2/3 steps found)
- 6-hydroxymethyl-dihydropterin diphosphate biosynthesis I (3/5 steps found)
- 6-hydroxymethyl-dihydropterin diphosphate biosynthesis III (Chlamydia) (3/5 steps found)
- 6-hydroxymethyl-dihydropterin diphosphate biosynthesis V (Pyrococcus) (1/4 steps found)
- 6-hydroxymethyl-dihydropterin diphosphate biosynthesis II (Methanocaldococcus) (2/7 steps found)
- superpathway of chorismate metabolism (35/59 steps found)
- tetrahydromethanopterin biosynthesis (2/14 steps found)
KEGG Metabolic Maps
Isozymes
No predicted isozymesUse Curated BLAST to search for 2.7.6.3
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A1X9Z1P8 at UniProt or InterPro
Protein Sequence (168 amino acids)
>CA265_RS04420 2-amino-4-hydroxy-6- hydroxymethyldihydropteridine diphosphokinase (Pedobacter sp. GW460-11-11-14-LB5) MMLNKALECSTAYLLLGGNLGDREANLKKAIDLLNDKIGKVIAISSLYETAAWGKTDQPA FLNQAVGVETNLSAIAVLDLALSIEQELGRVRKDKWGERLIDIDLILFGDQIIDIPDKLQ VPHPHMQNRKFVMEPLAEIAPEVVHPVLGETILSICRNIDDPLEVKKL