Protein Info for CA265_RS04375 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: cystathionine beta-synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00291: PALP
  • amino acids 7 to 302 (296 residues), 251.5 bits, E=1.2e-78
• PF00571: CBS
  • amino acids 340 to 389 (50 residues), 26.8 bits, 5.4e-10
  • amino acids 399 to 452 (54 residues), 24.5 bits, 2.9e-09

Best Hits

KEGG orthology group: K01697, cystathionine beta-synthase [EC: 4.2.1.22] (inferred from 90% identity to phe:Phep_1434)

Predicted SEED Role

"Cystathionine beta-synthase (EC 4.2.1.22)" in subsystem Cysteine Biosynthesis or Glycine and Serine Utilization or Methionine Biosynthesis or Methionine Degradation (EC 4.2.1.22)

MetaCyc Pathways

• superpathway of sulfur amino acid biosynthesis (Saccharomyces cerevisiae) (9/10 steps found)
• superpathway of L-cysteine biosynthesis (fungi) (5/6 steps found)
• L-cysteine biosynthesis III (from L-homocysteine) (2/2 steps found)
• superpathway of L-cysteine biosynthesis (mammalian) (4/5 steps found)
• homocysteine and cysteine interconversion (3/4 steps found)
• hydrogen sulfide biosynthesis II (mammalian) (4/6 steps found)
• taurine biosynthesis III (1/3 steps found)
• superpathway of L-methionine salvage and degradation (9/16 steps found)

KEGG Metabolic Maps

• Glycine, serine and threonine metabolism
• Methionine metabolism
• Selenoamino acid metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.22

Sequence Analysis Tools

See A0A1X9Z1A0 at UniProt or InterPro

Protein Sequence (453 amino acids)

>CA265_RS04375 cystathionine beta-synthase (Pedobacter sp. GW460-11-11-14-LB5)
MWYNNILETIGNTPLVKLNTITKGVPGTILAKIETTNPGNSIKDRMAVKMIEDAEKSGKL
KPGGTIIEGTSGNTGMGLAMAAIIKGYKCIFTTTDKQSKEKVDALRAFGAEVIVCPTNVE
PEDPRSYYSVSSRLEREVPNSWKPNQYDNLANSQAHYEQTGPEIWAQTEGKITHLVVGVG
TGGTISGTGKYLKEKNPNIKVWGIDTYGSVFKKYKETGIFDKDEIYPYITEGIGEDFLPA
NVNFDVIDLFEKVTDKDAALMTRDIARKEGIFVGNSAGAAIGGLIQLKDKLKPEDVVVVI
FHDHGSRYMGKMYNEDWLRERGFLQDEKLTAKSILSKKESTEIVTLDAQKSVLEAINTIK
SMNISQIPVTQQGMIVGKIAESDILSALLENPGLKSAPISEIMTATFPFVDLNTSIDKIS
SLINKENSAVLVEDETGKIEIITQYDIINAISG