Protein Info for CA265_RS04280 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: AMP nucleosidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 268 TIGR01721: putative AMP nucleosidase" amino acids 13 to 257 (245 residues), 330.4 bits, see alignment E=3.6e-103 PF01048: PNP_UDP_1" amino acids 71 to 248 (178 residues), 117.3 bits, see alignment E=3.7e-38

Best Hits

KEGG orthology group: K01241, AMP nucleosidase [EC: 3.2.2.4] (inferred from 91% identity to phe:Phep_3079)

Predicted SEED Role

"AMP nucleosidase (EC 3.2.2.4)" in subsystem Purine conversions (EC 3.2.2.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.2.2.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z132 at UniProt or InterPro

Protein Sequence (268 amino acids)

>CA265_RS04280 AMP nucleosidase (Pedobacter sp. GW460-11-11-14-LB5)
MKEVESPVKSGLKSKDEIVKNWLPRYTGRPLDQFGDYILLTNFSKYVSMFSEWNDNAPIM
GLDKPMQSVTANGITIINFGMGSPLAATMMDLLTAIKPKAVLFLGKCGGLKKKNQLGDLI
LPIAAIRGEGTSNDYLPAEVPALPAFALQKAISTTIRDHGRDYWTGTCYTTNRRVWEHDK
EFKKYLKTLRAMAVDMETATVFTTAFANKIPAGALLLVSDQPMIPEGVKTAESDSSVTEK
YVETHLRIGIDSLKQLINNGLTVKHLLF