Protein Info for CA265_RS04260 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: trigger factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 PF05697: Trigger_N" amino acids 1 to 149 (149 residues), 118.5 bits, see alignment E=3.2e-38 TIGR00115: trigger factor" amino acids 12 to 427 (416 residues), 207.6 bits, see alignment E=1.5e-65 PF05698: Trigger_C" amino acids 282 to 378 (97 residues), 24.8 bits, see alignment E=2.1e-09

Best Hits

KEGG orthology group: K03545, trigger factor (inferred from 75% identity to phe:Phep_3082)

Predicted SEED Role

"Cell division trigger factor (EC 5.2.1.8)" in subsystem Bacterial Cell Division (EC 5.2.1.8)

Isozymes

Compare fitness of predicted isozymes for: 5.2.1.8

Use Curated BLAST to search for 5.2.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z1L7 at UniProt or InterPro

Protein Sequence (450 amino acids)

>CA265_RS04260 trigger factor (Pedobacter sp. GW460-11-11-14-LB5)
MNITQEKTGNLNAVVKIKIAPADYSGKVEKAIKDQAKKAQLPGFRKGMVPAAHIKKMYGK
SILVEEVNNLLNDTLSNYIAEQKLEILGQPLPKMDDEREFKWDNTDDFEFDYELGLAPAF
DVNLSSKDKFTEYVIKADKETLESRIKNIRRSYGKMTNPEVSADDDVLYTELTQVAADGT
AVEGGITSTATIRLDQIKDKKILKSLIGLKKDDEVTIDIQKALEDAAVIAKALNISEEEA
AELKANFKLHVKNVNRLEESDLNQEFFDKLFGEGTVTDEAGFRAKITEEVESMFKQDAER
KLSNDIYEALLAKHTFELPDEFLRRWLKATNEKLTDEELTEGYDDFAKNLKWTLIENKII
KDNSIEIKYEDVVQAAKAKLDAQFRMYSPSPLPEDQLAQYAVQFLQEKENANRVFEEVKA
LKTFEQIKSVVTLEQKDIDYDKFIALDKKA