Protein Info for CA265_RS04230 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: short-chain dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 256 PF00106: adh_short" amino acids 7 to 196 (190 residues), 162.8 bits, see alignment E=1e-51 PF08659: KR" amino acids 9 to 165 (157 residues), 41.7 bits, see alignment E=1.8e-14 PF13561: adh_short_C2" amino acids 15 to 248 (234 residues), 200.2 bits, see alignment E=6.1e-63

Best Hits

Swiss-Prot: 34% identical to SDR2A_ARATH: Short-chain dehydrogenase reductase 2a (SDR2a) from Arabidopsis thaliana

KEGG orthology group: None (inferred from 56% identity to rca:Rcas_2118)

Predicted SEED Role

"D-beta-hydroxybutyrate dehydrogenase (EC 1.1.1.30)" in subsystem Polyhydroxybutyrate metabolism (EC 1.1.1.30)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.30

Use Curated BLAST to search for 1.1.1.30

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z1A8 at UniProt or InterPro

Protein Sequence (256 amino acids)

>CA265_RS04230 short-chain dehydrogenase (Pedobacter sp. GW460-11-11-14-LB5)
MNMLHHKIIILTGGADGIGWECAKAYSKAGATVCILDKNPIAESKLNELETAQKIAITCN
LVNENEVAAAFETIIQKFGNIDAIHNNAGIAHPSKTLDQTTDAEWDLLMNVNLKSILYTT
RYGIEQLKKTKGCILNTSSMVGTIGQDNHAAYVATKGAINALTKAMALDYAPYQIRVNAV
SPAAINTPTLQLWSKEQPNKEEIQHYLDKLQPLGGMPAGDVIADACLFLLSDAARFITGT
ILPVSGGAELGYRTII