Protein Info for CA265_RS04080 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 811 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF13620: CarboxypepD_reg" amino acids 22 to 95 (74 residues), 52.1 bits, see alignment E=1.8e-17 PF13715: CarbopepD_reg_2" amino acids 23 to 106 (84 residues), 68.3 bits, see alignment E=1.2e-22 PF08308: PEGA" amino acids 36 to 98 (63 residues), 25.3 bits, see alignment 2.9e-09 PF07715: Plug" amino acids 115 to 218 (104 residues), 58.4 bits, see alignment E=2.4e-19 TIGR01783: TonB-dependent siderophore receptor" amino acids 117 to 810 (694 residues), 231.7 bits, see alignment E=9.7e-73 PF00593: TonB_dep_Rec" amino acids 310 to 768 (459 residues), 64.8 bits, see alignment E=3.5e-21

Best Hits

KEGG orthology group: None (inferred from 41% identity to shm:Shewmr7_3720)

Predicted SEED Role

"Aerobactin siderophore receptor IutA" in subsystem Iron acquisition in Vibrio or Siderophore Aerobactin or Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z0Y0 at UniProt or InterPro

Protein Sequence (811 amino acids)

>CA265_RS04080 hypothetical protein (Pedobacter sp. GW460-11-11-14-LB5)
MKNLYLIAILVCGFMLTGKAQTVTGKVIGETAPLAGANIKVEGKNASATTAADGSFELKL
TEGAYKLQVSYVGYTTILQKVSLAKDQTVNLTLYLSPTSNMQEVVVVSSRKPTKISEIPG
TVWVVDGAKIQEQARAGIPLKQTLAQLIPSLDAGPEGRTNYGQNQRGRDALVMIDGVSLN
STRGVSRQFESIDPFNIERIEVLSGASAVYGGGATGGIINIITKKGQDSQPSFTTQVGVR
SGLKEKSDHDVRVAQAISGGSKDWNGRIGMAFQKNNAAYGADGKQIFTDITQTDLQYNQS
FDFFGSTEFKLTDYQKLSVNAQYYNSGYRGDKDLFLGTNYGGLLSNPALLEMRNGYSADV
DPKTSRANINANYQASDILGGQTLYVQAAARNEKFSFHPFPGQAAIPGVLYSGSSIQNTN
YSALKLVLNKDWNRLNLTYGIDADNENFNAQQALFDRTKAATSGGLNNTTVATIARYPNF
RVNGLSGFLQAQVKVADFLTLSGGVRQQRMFVKVGDFVGTAAAVPLAYGVGRTATAIAGG
ENHYDVNLLNGGLVFKINAPQQAWVNFSQGFNLADPAKYYGQGAYTLAGTNWNLGNSINV
ASSPLTGIKTEQYEAGYRYRTGVFNAQVAGFYALSDKNVKTNSTFNIEVFDENVRNIGVE
GSLSLNLQNGFEAGVNGLYIKTQKQNADGTWSLQDVTVASPSKIAGYLGYNGKVFGLKAQ
AFHSFDSKGYATIANVAVQNELKGFTTVDLLGSVKLFTGSLSFGVQNLLNKNYQTIWSQR
SQFLYQSLAKKETFYYAGRGRTYNLTYTLNY