Protein Info for CA265_RS04015 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 733 transmembrane" amino acids 174 to 195 (22 residues), see Phobius details amino acids 211 to 229 (19 residues), see Phobius details amino acids 285 to 308 (24 residues), see Phobius details amino acids 314 to 333 (20 residues), see Phobius details PF03412: Peptidase_C39" amino acids 4 to 127 (124 residues), 113.5 bits, see alignment E=9.8e-37 PF00664: ABC_membrane" amino acids 178 to 444 (267 residues), 80 bits, see alignment E=3.6e-26 PF00005: ABC_tran" amino acids 509 to 658 (150 residues), 92.1 bits, see alignment E=7.8e-30

Best Hits

KEGG orthology group: K06147, ATP-binding cassette, subfamily B, bacterial (inferred from 67% identity to phe:Phep_0558)

Predicted SEED Role

"ABC transporter ATP-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z168 at UniProt or InterPro

Protein Sequence (733 amino acids)

>CA265_RS04015 ABC transporter ATP-binding protein (Pedobacter sp. GW460-11-11-14-LB5)
MKKFPFFKQLDQMDCGPSCLRMIAKFYGRNYSLQRLREISGINKQGVSLLGISEAAEKIG
FRTFGTKLGLEKLNEVELPVILHWKQKHFVVLHQITTKSPRKKIYHIADPAKGLINYKES
EFIKYWVNGTGQSHIDGVSLLLSPTPSFFNQGGDPDKGLNFSYMLGYLYKYKKLILQLFL
GLLVGSLLQLILPFLTQSVVDVGINTRNLNFVYIVLIAQTMLFLGRMSVDFIRSWILLHM
TTRLNISILTDFLIKLMKLPMHFFETKMTGDIMQRMSDQSRIQSFLTGPSLNTIFTSFNL
IIFAFVLAYYNLNIFMIFLVSSILYSLWVMFFLKKRRELDMKRFDISSENQGNIVQLISG
MQEIKLNNCEQQKRWEWERIQASLFKFSVKSLALGQYQRFGAFFINEGKNIIITFTVVKS
VIDGNLTLGAMMAVQYVVGQLSSPVEQILGFLQAYQDAKISLERLNEIHELKDEEPIDKK
FIYELPIQKTINIQKLSFTYPGAGNDPVLNDIDLIIPEGKTTAIVGMSGSGKTTILKLLL
RFYDVEKGDIKIGNTSLSQIGYKYWRSQCGIVMQDGFIFSDTIARNIAVGDEYPDRSKLQ
HAIDVANIGDFIDTLPLGVETKIGAAGNGISQGQRQRLLIARAVYKDPMYIFFDEATNAL
DANNEKVIMKNLETFFKGRTVVVVAHRLSTVKNADHIIVLDKGRIIEKGTHRELVNASGE
YFELVKNQLEIGV