Protein Info for CA265_RS03640 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: ATP phosphoribosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 283 TIGR00070: ATP phosphoribosyltransferase" amino acids 4 to 184 (181 residues), 189.8 bits, see alignment E=4.2e-60 PF01634: HisG" amino acids 51 to 203 (153 residues), 175 bits, see alignment E=1.2e-55 TIGR03455: ATP phosphoribosyltransferase, C-terminal domain" amino acids 192 to 282 (91 residues), 99.5 bits, see alignment E=9.9e-33 PF08029: HisG_C" amino acids 208 to 280 (73 residues), 96.3 bits, see alignment E=9.2e-32

Best Hits

Swiss-Prot: 50% identical to HIS1_BACTN: ATP phosphoribosyltransferase (hisG) from Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)

KEGG orthology group: K00765, ATP phosphoribosyltransferase [EC: 2.4.2.17] (inferred from 83% identity to phe:Phep_3191)

Predicted SEED Role

"ATP phosphoribosyltransferase (EC 2.4.2.17)" in subsystem Histidine Biosynthesis (EC 2.4.2.17)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z1B2 at UniProt or InterPro

Protein Sequence (283 amino acids)

>CA265_RS03640 ATP phosphoribosyltransferase (Pedobacter sp. GW460-11-11-14-LB5)
MKTLKIAIQKSGRLNEKSVEILKNCGLSFENYKSSLISTVTNFPLEILFLRDDDIPEYVQ
DGIADLGIVGENVIVETKAEVDYLQKLGFGKCTLKIAVQATSNIQKLEELNGKAIATSYP
VILEKFLQEKGIKSDIRTISGSVEIGPGLGLSDAIFDIVSTGGTLKSNGLKPFADVMQSE
AVLIGNKSIADNPEVAELLQRIRSVLSAKSNKYVVLNVSKDNLQKVVDLLPGVKSPTVVP
LFEPNWVAVHSVIAEEDFWDKINSLKAAGAEGILVMPIEKIIR