Protein Info for CA265_RS03560 in Pedobacter sp. GW460-11-11-14-LB5
Annotation: nucleotide exchange factor GrpE
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 49% identical to GRPE_BACTN: Protein GrpE (grpE) from Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)
KEGG orthology group: K03687, molecular chaperone GrpE (inferred from 65% identity to phe:Phep_3208)Predicted SEED Role
"Heat shock protein GrpE" in subsystem Heat shock dnaK gene cluster extended or Protein chaperones
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A1X9Z0R2 at UniProt or InterPro
Protein Sequence (193 amino acids)
>CA265_RS03560 nucleotide exchange factor GrpE (Pedobacter sp. GW460-11-11-14-LB5) MFNKKKNNDKEENIMNPENTSENTAENVENTDAPTAETEQAPELSAEEKLQAEVQQLNDK YLRLYAEFDNYKRRTQKERVELLQTAGKDVIVSLLPVLDDFDRALKAMETAADVAPVKEG ILLVSTKLKNTLAQKGLKDVESISQPFNTDFHEAITNIPAPSDDLKGKVIDEVEKGYTLN DNVIRFAKVVVGA