Protein Info for CA265_RS03520 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 175 TIGR01662: HAD hydrolase, family IIIA" amino acids 11 to 123 (113 residues), 46.6 bits, see alignment E=3.8e-16 TIGR01670: 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase, YrbI family" amino acids 12 to 160 (149 residues), 133.9 bits, see alignment E=4.7e-43 PF08282: Hydrolase_3" amino acids 77 to 143 (67 residues), 25.1 bits, see alignment E=1.4e-09

Best Hits

Swiss-Prot: 31% identical to KDSC_HAEIN: 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase KdsC (HI_1679) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K03270, 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase (KDO 8-P phosphatase) [EC: 3.1.3.45] (inferred from 71% identity to phe:Phep_3213)

Predicted SEED Role

"3-deoxy-D-manno-octulosonate 8-phosphate phosphatase (EC 3.1.3.45)" in subsystem KDO2-Lipid A biosynthesis (EC 3.1.3.45)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.3.45

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z106 at UniProt or InterPro

Protein Sequence (175 amino acids)

>CA265_RS03520 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase (Pedobacter sp. GW460-11-11-14-LB5)
MFLQKLKEITTFIFDVDGVLTDGSVQVTDNGQSLRTFNIKDGYAMQLAVKRGYNICIISG
GDGIAMGKRFFNLGVTDVFLGTGDKVAIFNQYLQDKNITAGEVLYMGDDIPDLKVMKLVG
LPTCPADAVEEIKAISTFVSPYNGGKTSVRDIIEKVMKVQGRWHDENPNAADSGM