Protein Info for CA265_RS03260 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: multidrug ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00005: ABC_tran
  • amino acids 19 to 160 (142 residues), 110.8 bits, E=8.8e-36

Best Hits

Swiss-Prot: 37% identical to NATA_BACSU: ABC transporter ATP-binding protein NatA (natA) from Bacillus subtilis (strain 168)

KEGG orthology group: K09687, antibiotic transport system ATP-binding protein (inferred from 69% identity to phe:Phep_3248)

MetaCyc: 37% identical to Na+ ABC efflux transporter ATP-binding protein (Bacillus subtilis subtilis 168)
RXN-17739 [EC: 7.2.2.3, 7.2.2.4]

Predicted SEED Role

"ABC-type multidrug transport system, ATPase component"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.2.2.3 or 7.2.2.4

Sequence Analysis Tools

See A0A1X9Z0S3 at UniProt or InterPro

Protein Sequence (235 amino acids)

>CA265_RS03260 multidrug ABC transporter ATP-binding protein (Pedobacter sp. GW460-11-11-14-LB5)
MSISVKNLSKHYDKQKAVDSISFEAKPGRILGFLGPNGAGKSTTMRMLTGYLEPTSGEAE
ISGKSILSEAIEAKKHIGYLPENTPLYADMYVKEFLNFVGQTYKLSHLPTRIDEVIKMVG
LTAEQHKKIGMLSKGYRQRVGLAQAIIHNPEVLILDEPTSGLDPNQLVDIRQLIKTLGAA
KTVIISTHIMQEVEAICDDIIIISKGKIVAKDSLEGLKKNHQQQSLEDIFRKLTA