Protein Info for CA265_RS03015 in Pedobacter sp. GW460-11-11-14-LB5
Annotation: tRNA-specific adenosine deaminase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 53% identical to GUAD_BACSU: Guanine deaminase (guaD) from Bacillus subtilis (strain 168)
KEGG orthology group: None (inferred from 73% identity to phe:Phep_0860)Predicted SEED Role
"Guanine deaminase (EC 3.5.4.3)" in subsystem Purine Utilization or Purine conversions (EC 3.5.4.3)
MetaCyc Pathways
- purine nucleotides degradation II (aerobic) (10/11 steps found)
- guanosine nucleotides degradation III (4/4 steps found)
- guanosine nucleotides degradation II (3/4 steps found)
- drosopterin and aurodrosopterin biosynthesis (5/7 steps found)
- superpathway of guanosine nucleotides degradation (plants) (3/6 steps found)
- purine nucleotides degradation I (plants) (7/12 steps found)
- purine nucleobases degradation II (anaerobic) (15/24 steps found)
- purine nucleobases degradation I (anaerobic) (5/15 steps found)
- superpathway of purines degradation in plants (7/18 steps found)
KEGG Metabolic Maps
Isozymes
No predicted isozymesUse Curated BLAST to search for 3.5.4.3
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A1X9Z124 at UniProt or InterPro
Protein Sequence (158 amino acids)
>CA265_RS03015 tRNA-specific adenosine deaminase (Pedobacter sp. GW460-11-11-14-LB5) MDNQHQKYMQMAIELSVQNVSESIGGPFGAVVVKDGKLIAKSANKVTSTNDPTAHAEVSA IRLACNELNTFDLSGCVIYTSCEPCPMCLGAIYWAKIDTIYYANTKADAEHIGFSDKFIY EELDKPMENRSLPVVQLMRDEALAAFKLWETSPMRIAY