Protein Info for CA265_RS02670 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: thymidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00265: TK
  • amino acids 16 to 188 (173 residues), 183.9 bits, E=1.3e-58

Best Hits

Swiss-Prot: 66% identical to KITH_BACV8: Thymidine kinase (tdk) from Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / NBRC 14291 / NCTC 11154)

KEGG orthology group: K00857, thymidine kinase [EC: 2.7.1.21] (inferred from 84% identity to phe:Phep_0802)

Predicted SEED Role

"Thymidine kinase (EC 2.7.1.21)" in subsystem Folate Biosynthesis (EC 2.7.1.21)

MetaCyc Pathways

• superpathway of pyrimidine deoxyribonucleoside salvage (8/9 steps found)
• pyrimidine deoxyribonucleosides salvage (4/5 steps found)

KEGG Metabolic Maps

• Drug metabolism - other enzymes
• Pyrimidine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.21

Sequence Analysis Tools

See A0A1X9Z0V9 at UniProt or InterPro

Protein Sequence (193 amino acids)

>CA265_RS02670 thymidine kinase (Pedobacter sp. GW460-11-11-14-LB5)
MLFSEQNFRRRGEFSGSIEVVCGSMFSGKTEELIRRLKRAQIAKLNVEIFKPRTDTRYHE
TAVVSHDLNSINSTPVDSASAILLLGTNTQVVGIDEAQFFDDELPDVCNKLALKGIRVIV
AGLDMDFTGKPFGPMPALMAIAEHVTKVNAVCVCCGNPALYSYRTVADEATVLLGEKESY
EPRCRACYNLGKG