Protein Info for CA265_RS02570 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: GNAT family N-acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 160 PF13302: Acetyltransf_3" amino acids 3 to 138 (136 residues), 27.2 bits, see alignment E=1.2e-09 PF00583: Acetyltransf_1" amino acids 34 to 137 (104 residues), 73.2 bits, see alignment E=4.4e-24 PF13673: Acetyltransf_10" amino acids 37 to 143 (107 residues), 40.4 bits, see alignment E=5.6e-14 PF13508: Acetyltransf_7" amino acids 52 to 139 (88 residues), 54.9 bits, see alignment E=1.9e-18

Best Hits

Swiss-Prot: 42% identical to YJGM_SALTY: Uncharacterized N-acetyltransferase YjgM (yjgM) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K03828, putative acetyltransferase [EC: 2.3.1.-] (inferred from 62% identity to cpi:Cpin_6761)

MetaCyc: 42% identical to O-acetyl-serine N-acetyltransferase, OatA (Salmonella enterica enterica serovar Typhimurium str. LT2)
RXN1R65-39

Predicted SEED Role

"Putative acetyltransferase"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z0Q6 at UniProt or InterPro

Protein Sequence (160 amino acids)

>CA265_RS02570 GNAT family N-acetyltransferase (Pedobacter sp. GW460-11-11-14-LB5)
MAITIRKITAADNTATAEMIRTILREFKIDKPGTVYTDPTTDELSTVFEHPQSAYWLAEE
DGLIIGGCGIYPTGGLPDGCVELVKLYTSASSRGKGIGKMLMEKSIESAQHFGYNEIYLE
SFPELTRAIAMYEKAGFKKLAAPLGNSGHFACNVWMLLVL