Protein Info for CA265_RS01990 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01087: UDP-N-acetylmuramoylalanine--D-glutamate ligase
  • amino acids 20 to 460 (441 residues), 392.9 bits, E=1.1e-121
• PF21799: MurD-like_N
  • amino acids 20 to 107 (88 residues), 36.1 bits, E=1.3e-12
• PF21377: MurD_N
  • amino acids 21 to 93 (73 residues), 30.1 bits, E=8.1e-11
• PF08245: Mur_ligase_M
  • amino acids 124 to 302 (179 residues), 105.9 bits, E=5.4e-34
• PF02875: Mur_ligase_C
  • amino acids 325 to 401 (77 residues), 32 bits, E=2.5e-11

Best Hits

Swiss-Prot: 55% identical to MURD_PORGI: UDP-N-acetylmuramoylalanine--D-glutamate ligase (murD) from Porphyromonas gingivalis (strain ATCC BAA-308 / W83)

KEGG orthology group: K01925, UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC: 6.3.2.9] (inferred from 77% identity to phe:Phep_3328)

Predicted SEED Role

"UDP-N-acetylmuramoylalanine--D-glutamate ligase (EC 6.3.2.9)" in subsystem Peptidoglycan Biosynthesis (EC 6.3.2.9)

MetaCyc Pathways

• peptidoglycan biosynthesis I (meso-diaminopimelate containing) (11/12 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis I (meso-diaminopimelate containing) (8/8 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis II (lysine-containing) (7/8 steps found)
• peptidoglycan biosynthesis III (mycobacteria) (11/15 steps found)
• peptidoglycan biosynthesis II (staphylococci) (12/17 steps found)
• peptidoglycan biosynthesis IV (Enterococcus faecium) (12/17 steps found)
• peptidoglycan biosynthesis V (β-lactam resistance) (11/17 steps found)

KEGG Metabolic Maps

• D-Glutamine and D-glutamate metabolism
• Peptidoglycan biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.9

Sequence Analysis Tools

See A0A1X9YZX2 at UniProt or InterPro

Protein Sequence (462 amino acids)

>CA265_RS01990 UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase (Pedobacter sp. GW460-11-11-14-LB5)
MSTNNITSSNTKSAMTGQGRVVILGAGESGVGAAKLAQAKGFDVFVSDYGVITDKYKAAL
EKLSIPFESEKHTEELILNASEVIKSPGIPPTAPIIKKLVAKGISVVSEIEFAKRYTHAK
TICITGSNGKSTTSLLTYHILKNAGLNVGLAGNIGQSFAAQVATEDYEYYVLEISSFMLD
DMFEFRADIAVLLNITPDHLDRYDYKLENYAASKMRIVQNQTAEDVFIYCADDEESLKAI
ALAKPLAKAFPFSITKKVEPGAYLEETTIHILTEPNNQLTMSISDLALQGKHNIYNSMAS
GIVSKVLELRNESIRESMGNFKNIEHRLEHVAKISGIDFINDSKATNVNSTWYALESMTS
DVVLIMGGVDKGNDYNMLKDLVKSKVKAIVCLGKDNKRIHDAFEDDVEVIVNTFSAEEAA
QIAFHLAKRGDAVLLSPACASFDLFKNYEDRGNQFKAAVREL