Protein Info for CA265_RS01800 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 284 transmembrane" amino acids 48 to 71 (24 residues), see Phobius details amino acids 83 to 100 (18 residues), see Phobius details amino acids 124 to 151 (28 residues), see Phobius details amino acids 157 to 183 (27 residues), see Phobius details amino acids 193 to 214 (22 residues), see Phobius details amino acids 250 to 273 (24 residues), see Phobius details PF01061: ABC2_membrane" amino acids 31 to 244 (214 residues), 76.6 bits, see alignment E=1e-25

Best Hits

KEGG orthology group: K09690, lipopolysaccharide transport system permease protein (inferred from 78% identity to psn:Pedsa_2309)

Predicted SEED Role

"O-antigen export system, permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z0B3 at UniProt or InterPro

Protein Sequence (284 amino acids)

>CA265_RS01800 ABC transporter permease (Pedobacter sp. GW460-11-11-14-LB5)
MVKEEQQWTIEAKSSLFDLKLHEVWAYRDLLVLLVRRDFVSFYKQTILGPLWFFIQPLFT
TIIFTFIFGNLAGISTDSLPKPLFYMAGITAWNYFADCLTKTSSVFRDNAGIFGKVYFPR
LIMPLSIVVSNLVRFGVQMLLFLILMAYYYFSGANFNISWAICLFPVIVILMALLGLGAG
MIISAMTTKYRDLAFLIGFGVQLLMYATTVIYPLSEAINKYPAYAWIIEYNPMTPIIETF
RYGFLGQGSFSWFSLGYATIVTIFLLLIGTVVFNKVERNFVDTV