Protein Info for CA265_RS01600 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: cytochrome C

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 720 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 42 to 62 (21 residues), see Phobius details amino acids 81 to 101 (21 residues), see Phobius details amino acids 113 to 131 (19 residues), see Phobius details amino acids 142 to 161 (20 residues), see Phobius details PF09990: DUF2231" amino acids 42 to 164 (123 residues), 42.1 bits, see alignment E=1.8e-14 PF07635: PSCyt1" amino acids 203 to 262 (60 residues), 48.7 bits, see alignment 1.9e-16 PF13290: CHB_HEX_C_1" amino acids 496 to 549 (54 residues), 45.3 bits, see alignment 1.4e-15 PF13287: Fn3_assoc" amino acids 505 to 557 (53 residues), 48.1 bits, see alignment 2.1e-16

Best Hits

KEGG orthology group: None (inferred from 53% identity to dfe:Dfer_1976)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YZQ1 at UniProt or InterPro

Protein Sequence (720 amino acids)

>CA265_RS01600 cytochrome C (Pedobacter sp. GW460-11-11-14-LB5)
MKITLKGFAENVLFMANAFIIFLLVFGNRIAVPYWLQPLGRMHPMVLHFPIVILLLAMLL
EFFRFKDTYAKEKLYHDFTSWLLLAGTLFSAVTVIMGLFLSKEEGYSGNILQWHKWTGVS
IVFITTFIYYCRNAAWYKLPVARGGAVLTILSVILAGHYGAALTHGDNFVLEPVSSPAES
AKVPLEQAKVFEDVVMPIFSQKCLSCHNIEKAKGNLIMDNAQAILKGGKTGKLFVPGKPE
LSLLIERIHLPLDEKKHMPPRGKSQLTEKEIQLLKLWVKNNAEMKKKVVDLPATDSLRLL
ATTFLAPVETPEEKFEFAAADESTVKKLNNNYRNVYSLAKESPALAVNIYNKSVYKPSVL
KELSEVKKQIISLNLSGMPVSDDDLKIISGFENLRKLNLNFTNITGTGLKHLVILPHLNA
LSLSGTKVSYNLVKQVLNMGGLRQLTLWNTGLSEAEVSQLQKINKNLTVVTGFKDDGKHP
VKLNKPRLNTDITVFKDAITLQMKHLINGVKIRYTTDGTEPDSLKSPIYNKEIVLSGNTT
IKAKAYKAGWYGSDVLVANFYRSTYKPDSISFLLPANEKYRAGGAKVLIDNQLGDYDFNL
GKWIAFRENNMEAMLYFKQPVTLQSITLHVMKQIQPYIFPPTDVEVWGGATQNKLHLLGR
LRPDIPKKMEEREFIKIEAKFKSQRISCLKIVAKNLKKLPEWHPAKGQPAWLFVDELFLN