Protein Info for CA265_RS01385 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: cytochrome C

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 255 transmembrane" amino acids 69 to 90 (22 residues), see Phobius details PF14715: FixP_N" amino acids 52 to 95 (44 residues), 64 bits, see alignment 1.2e-21 PF13442: Cytochrome_CBB3" amino acids 138 to 211 (74 residues), 43.7 bits, see alignment E=4.3e-15 PF00034: Cytochrom_C" amino acids 139 to 215 (77 residues), 39 bits, see alignment E=2.6e-13

Best Hits

Predicted SEED Role

"Cytochrome c oxidase subunit CcoP (EC 1.9.3.1)" in subsystem Terminal cytochrome C oxidases (EC 1.9.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.9.3.1

Use Curated BLAST to search for 1.9.3.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9ZC36 at UniProt or InterPro

Protein Sequence (255 amino acids)

>CA265_RS01385 cytochrome C (Pedobacter sp. GW460-11-11-14-LB5)
MYQEQLNPTPYTEPIKEPVLDYDTWLKQQPVKPSIWTKILSLRPIEEEKDLVIDHAYDGI
KELNNPVPAWFNFLFYGTMIFAAAYLFYYHIGGYGDLQDKEYENEMAKAQVEKAAYLEKS
ANTIDENSVKFDNTATVLEDGKTIFNTNCVVCHGDKGQGLIGPNLTDEYWLHGGGVNNVF
KTIKYGVPEKGMISWEKNLNPKQISAVTNFILSLKGTNPAGAKAPQGEKYEAKDLKDNEM
KAPKDSVNKADVIKK