Protein Info for CA265_RS01345 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: PAS domain-containing sensor histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 396 TIGR00229: PAS domain S-box protein" amino acids 3 to 127 (125 residues), 103.1 bits, see alignment E=5.7e-34 PF00989: PAS" amino acids 6 to 117 (112 residues), 67.1 bits, see alignment E=4.1e-22 PF13188: PAS_8" amino acids 6 to 60 (55 residues), 33.2 bits, see alignment 1.1e-11 PF08448: PAS_4" amino acids 12 to 73 (62 residues), 27.4 bits, see alignment E=1e-09 PF13426: PAS_9" amino acids 16 to 119 (104 residues), 55.5 bits, see alignment E=1.8e-18 PF00512: HisKA" amino acids 174 to 241 (68 residues), 48.7 bits, see alignment E=1.9e-16 PF02518: HATPase_c" amino acids 287 to 394 (108 residues), 86.7 bits, see alignment E=4.6e-28

Best Hits

KEGG orthology group: None (inferred from 64% identity to shg:Sph21_3521)

Predicted SEED Role

"sensor histidine kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z031 at UniProt or InterPro

Protein Sequence (396 amino acids)

>CA265_RS01345 PAS domain-containing sensor histidine kinase (Pedobacter sp. GW460-11-11-14-LB5)
MDRSKFLDAIIENAIDGIITIDDKGIIEHLNPAALELFGYDKAELVGKNVSVLMPEPDHS
RHDGYLSRYEHTGQKHIIGVGREVSGKRKDGSVFPFRLGVSEIEFSDRKIYTGFIHDLSK
EKANEEQIRSYTEKLEVKIKERTHDLVKLVSELEMAKENMQALFQKEKELNQLKTRFVSM
ASHEFRTPLSSIQLSASLIDKYTSKQDVASVEKHTLKIKNSINNLTTILNDFLSLEKLEA
GKVEASAQTFNIISFAEEIAEEMQMMTKENQHIIYEHTGTTAEVYLDPNLLKNCVINLIS
NSIKYSGADTLIQFNSILKDDELLLEVKDNGIGIPKVDQNNLFEPFFRAHNTGDIPGTGL
GLNIVKRYVGLMNGTVACQSEQNSGTVFTLRFTFRK