Protein Info for CA265_RS01050 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: sodium:solute symporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 564 transmembrane" amino acids 6 to 23 (18 residues), see Phobius details amino acids 43 to 62 (20 residues), see Phobius details amino acids 74 to 95 (22 residues), see Phobius details amino acids 117 to 138 (22 residues), see Phobius details amino acids 148 to 167 (20 residues), see Phobius details amino acids 179 to 196 (18 residues), see Phobius details amino acids 231 to 250 (20 residues), see Phobius details amino acids 271 to 296 (26 residues), see Phobius details amino acids 404 to 427 (24 residues), see Phobius details amino acids 459 to 479 (21 residues), see Phobius details amino acids 485 to 504 (20 residues), see Phobius details amino acids 511 to 529 (19 residues), see Phobius details amino acids 535 to 555 (21 residues), see Phobius details PF00474: SSF" amino acids 33 to 299 (267 residues), 75.4 bits, see alignment E=2.2e-25 amino acids 385 to 510 (126 residues), 41.7 bits, see alignment E=3.6e-15

Best Hits

Predicted SEED Role

"Sodium iodide symporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YZB4 at UniProt or InterPro

Protein Sequence (564 amino acids)

>CA265_RS01050 sodium:solute symporter (Pedobacter sp. GW460-11-11-14-LB5)
MSNIDWAVLIFTLMAVVAYGVFIGRGQKSNASYLKADNKMPWYIVLLGIMATQASAITFL
SAPGQAYTDGMRFVQYYFGLPLAMIVICITFIPIFQRLNVYTAYEYLENRFDKKTRVLTS
LLFLFSRGLSTGISIYAPSIILSSVLNWNIYLTNILTGGILLIYTYVGGAKAIAHTQKLQ
FLIILGTMAFAGYLLMQNMPNGIGFKDALYLAGKSGKLNVITTEFDWKDKYNIWSGLIGG
FFLALSYFGTDQSQVGRYITAKDNTNAKMGLLLNGLVKIPMQFAILLIGALLFAFFSLKP
APIYFNERSYQYLKETQPLQAAAFEKEHHTLAQQFNRQSKDILLEKEKQSPHLNSSIANF
KSTQKKVKDLHGRVEEAINKSNYNAEKTDTNYIFLYFVKNTLPVGMIGLLFAVIFLASWG
SISAALNSLAACSLKDVHLIFNKKEVDDETELKYSRLHTLAWGIFSIAVAMFATQMGSLI
EAVNVLGSLFYGPILGIFLVAFYFKKINGPIVFIAAILSEIAVVAVYEFDIVSFLWLNVI
GAAAVIMFSVIGLLFSNPKAVADR