Protein Info for CA265_RS00760 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: 2-deoxy-D-gluconate 3-dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00106: adh_short
  • amino acids 10 to 204 (195 residues), 188 bits, E=2.1e-59
• PF08659: KR
  • amino acids 11 to 192 (182 residues), 45.2 bits, E=1.5e-15
• PF13561: adh_short_C2
  • amino acids 18 to 251 (234 residues), 182.6 bits, E=1.5e-57

Best Hits

Swiss-Prot: 34% identical to FABG_STAAN: 3-oxoacyl-[acyl-carrier-protein] reductase FabG (fabG) from Staphylococcus aureus (strain N315)

KEGG orthology group: K00065, 2-deoxy-D-gluconate 3-dehydrogenase [EC: 1.1.1.125] (inferred from 82% identity to phe:Phep_2942)

MetaCyc: 73% identical to 2,5-didehydro-3-deoxy-L-galactonate 5-reductase (Pseudoalteromonas atlantica T6c)
2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase. [EC: 1.1.1.127]

Predicted SEED Role

"2-deoxy-D-gluconate 3-dehydrogenase (EC 1.1.1.125)" in subsystem D-Galacturonate and D-Glucuronate Utilization (EC 1.1.1.125)

MetaCyc Pathways

• 4-deoxy-L-threo-hex-4-enopyranuronate degradation (5/5 steps found)
• 2-deoxy-D-glucose 6-phosphate degradation (2/4 steps found)
• 3,6-anhydro-α-L-galactopyranose degradation (4/7 steps found)
• superpathway of microbial D-galacturonate and D-glucuronate degradation (18/31 steps found)

KEGG Metabolic Maps

• Pentose and glucuronate interconversions

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.125 or 1.1.1.127

Sequence Analysis Tools

See A0A1X9Z014 at UniProt or InterPro

Protein Sequence (254 amino acids)

>CA265_RS00760 2-deoxy-D-gluconate 3-dehydrogenase (Pedobacter sp. GW460-11-11-14-LB5)
MSNIFNLAGKTALVTGCKRGIGKAMALALAEAGADIIGVSASLELQGSAVEKEILALGRK
FYAYQCDFGKRENTLAFAAQVKADHPVIDILVNNAGTILRQPIAEHSDEYWDEVIAVNQT
APFILTREIGREMIARGSGKVIFTASLLSFQGGITVPGYAASKGAIASLTKAFANEWASK
GVNVNAIAPGYIATDNTSALREDQDRSTSILSRIPAGRWGTPEDFKGPTLFLASPASDYV
HGTILTVDGGWMGR