Protein Info for CA265_RS00630 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 365 transmembrane" amino acids 39 to 58 (20 residues), see Phobius details amino acids 64 to 85 (22 residues), see Phobius details amino acids 99 to 118 (20 residues), see Phobius details amino acids 161 to 184 (24 residues), see Phobius details amino acids 204 to 223 (20 residues), see Phobius details amino acids 228 to 252 (25 residues), see Phobius details PF00487: FA_desaturase" amino acids 64 to 335 (272 residues), 89.8 bits, see alignment E=1.2e-29

Best Hits

KEGG orthology group: K00508, linoleoyl-CoA desaturase [EC: 1.14.19.3] (inferred from 75% identity to cpi:Cpin_5677)

Predicted SEED Role

"Linoleoyl-CoA desaturase (EC 1.14.19.3)" (EC 1.14.19.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.14.19.3

Use Curated BLAST to search for 1.14.19.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YZH2 at UniProt or InterPro

Protein Sequence (365 amino acids)

>CA265_RS00630 hypothetical protein (Pedobacter sp. GW460-11-11-14-LB5)
MNKLRFIKDEGSAFYKELNEQVELYFVQNGLKKTGNAKMFFKIFLYFGLDILFYILMITS
DSVLAFYVFYLLMGLSVLLTAFNVSHDAAHGVAVKSKFWNRLLFSLSFNLQGNNAYVWGK
NHNESHHLYTNIEGSDIDVLNNPLFRMTESQPLKGYHRYQFIYAPFLYLFYSINWFFFRE
SLLLFNLSSRTIKVEIPRIEAIKLVVYKLLYIGYMIVLPVYLLPFGWAVVLMAFLLNHFI
ISLLFVAVLGVAHLSDYVSHPVPDEDNQLNMSWPKLQLLTSIDYHAESKFLNWTLGGFNA
HAVHHLLPNVCHVHYLHIIPIFKALAKKHKLTYMEMSYGESLASHFRFLKMMGKSEHLIP
MRYEG