Protein Info for CA265_RS00130 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: glycosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 310 transmembrane" amino acids 231 to 253 (23 residues), see Phobius details amino acids 262 to 287 (26 residues), see Phobius details PF13641: Glyco_tranf_2_3" amino acids 5 to 129 (125 residues), 29 bits, see alignment E=1.5e-10 PF00535: Glycos_transf_2" amino acids 6 to 143 (138 residues), 105.3 bits, see alignment E=5.1e-34 PF10111: Glyco_tranf_2_2" amino acids 6 to 107 (102 residues), 32.1 bits, see alignment E=1.3e-11

Best Hits

Swiss-Prot: 41% identical to YKCC_BACSU: Uncharacterized glycosyltransferase YkcC (ykcC) from Bacillus subtilis (strain 168)

KEGG orthology group: K00721, dolichol-phosphate mannosyltransferase [EC: 2.4.1.83] (inferred from 69% identity to psn:Pedsa_2808)

MetaCyc: 39% identical to undecaprenyl phosphate-N-acetyl-alpha-D-glucosamine transferase (Staphylococcus aureus)
2.4.2.-

Predicted SEED Role

"Glycosyltransferase"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.1.83

Use Curated BLAST to search for 2.4.1.83

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YZH0 at UniProt or InterPro

Protein Sequence (310 amino acids)

>CA265_RS00130 glycosyltransferase (Pedobacter sp. GW460-11-11-14-LB5)
MNKLVSIVIPAYNEADNIFVIAESIKKVFSTINYDYEIILVDDGSADHTLEKIKDYASTA
NNIFFLEFSKNFGHQLAVKAGMDHAFGDCVISMDCDMQHPPELIPEMLQKWQEGFEVVYT
IREEDKNLSKGKRSSSNLFYKTLNWLSDIDLEPGAADFRLLDQKVVSVFRNFHENEPFLR
GLVKWLGFKQFAIRYNPAARFSGNSKYTFKKMLRLALHGVTSFSIKPLYSAVYLGFILSF
ASVLYIPYIIYAFVNHVEVSGWASVIMTIVFFGGLQLIILGIIGIYVGKMFMQSKNRPNY
IIRSTNIQQK