Protein Info for BWI76_RS27960 in Klebsiella michiganensis M5al

Annotation: alcohol dehydrogenase protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 341 PF08240: ADH_N" amino acids 29 to 136 (108 residues), 68.2 bits, see alignment E=1e-22 PF00107: ADH_zinc_N" amino acids 177 to 301 (125 residues), 102.6 bits, see alignment E=2.4e-33 PF13602: ADH_zinc_N_2" amino acids 209 to 338 (130 residues), 52 bits, see alignment E=2.1e-17

Best Hits

KEGG orthology group: None (inferred from 91% identity to enc:ECL_00006)

Predicted SEED Role

"Alcohol dehydrogenase (EC 1.1.1.1)" in subsystem Fermentations: Mixed acid or Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 1.1.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.1

Use Curated BLAST to search for 1.1.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285AVA9 at UniProt or InterPro

Protein Sequence (341 amino acids)

>BWI76_RS27960 alcohol dehydrogenase protein (Klebsiella michiganensis M5al)
MTETMQRWSMNALGRENLKLTQAPVPQPGPGEVRVRVNAVALNYRDKMVIEGSMPIALSF
PFTPASDMAGVVESTGEGVTRFKPGARVISTFFPEWIDGRPTADARTLPYKTTGGYFQGM
LAEYVIVNENGLVAAPETLDDAEASTLPCAGLTAWFALVERGHLRAGQSVLVQGTGGVAI
FALQIAKAQGAEVFVTSGSDEKLARAKQLGADYGINRLKGDWAEGIYELTNDRGIDHIIE
TVGGENLRHSLRAVAVHGRISVIGVLAGSEISLSAGELLLKSPVIQGIGVGHRRALEDFV
RAVDVTGLKPVIEHRYRFNQLEQALEHLDRGAFGKIVLTHE