Protein Info for BWI76_RS27695 in Klebsiella michiganensis M5al

Annotation: multidrug efflux RND transporter permease subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 100 200 300 400 500 600 700 800 900 1035 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details transmembrane" amino acids 341 to 360 (20 residues), see Phobius details amino acids 367 to 389 (23 residues), see Phobius details amino acids 395 to 414 (20 residues), see Phobius details amino acids 439 to 460 (22 residues), see Phobius details amino acids 473 to 498 (26 residues), see Phobius details amino acids 535 to 553 (19 residues), see Phobius details amino acids 868 to 887 (20 residues), see Phobius details amino acids 894 to 914 (21 residues), see Phobius details amino acids 920 to 944 (25 residues), see Phobius details amino acids 968 to 989 (22 residues), see Phobius details amino acids 997 to 1023 (27 residues), see Phobius details PF00873: ACR_tran" amino acids 2 to 1024 (1023 residues), 1243.8 bits, see alignment E=0 TIGR00915: RND transporter, hydrophobe/amphiphile efflux-1 (HAE1) family" amino acids 2 to 1034 (1033 residues), 1544.6 bits, see alignment E=0 PF02355: SecD_SecF_C" amino acids 340 to 485 (146 residues), 21.1 bits, see alignment E=1.8e-08

Best Hits

Swiss-Prot: 57% identical to ACRB_ECOLI: Multidrug efflux pump subunit AcrB (acrB) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 62% identity to ant:Arnit_3082)

MetaCyc: 55% identical to multidrug efflux pump RND permease AcrD (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-1551; TRANS-RXN-1552; TRANS-RXN-360

Predicted SEED Role

"RND efflux system, inner membrane transporter CmeB" in subsystem Multidrug Resistance Efflux Pumps or Multidrug efflux pump in Campylobacter jejuni (CmeABC operon)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285BCB3 at UniProt or InterPro

Protein Sequence (1035 amino acids)

>BWI76_RS27695 multidrug efflux RND transporter permease subunit (Klebsiella michiganensis M5al)
MFSRFFVRRPVFAWVIAILIMLAGILAIRTLPVAQYPDVAPPAIKISATYTGASAETLEN
SVTQVIEQQLTGLDNLLYFTSTSSSDGSVSITVTFEQGTDPDTAQVQVQNKVQQAESRLP
SEVQQSGVTVEKSQSSFLLILAVYDKNNKATSSDISDWLVSNMQDPMARIEGVGSLQVFG
AEYAMRIWMDPTKLASYSLMPSDVQSAIEAQNVQVSAGKIGALPATNAQQLTATVRAQSR
LQTVAQFKEIIVKSKSDGSVVRLSDVARVEMGSEDYTASANLNGHPAAGIAVMMAPGANA
LNTATLVKNKIAEFQRQMPQGYDIAYPKDSTEFIKISVEDVIQTLFEAIILVVCVMYLFL
QNFRATLIPAVAVPVVLLGTFGVLALFGYSINTLTLFAMVLAIGLLVDDAIVVVENVERI
MRDEGLPAREATEKSMGEISGALIAIALVLSAVFLPMAFFGGSTGVIYRQFSVTIISAMM
LSVVVALTLTPALCGALLSHSKPHTKGFFGAFNRLWGRTEQGYQHRVVGGLRRSAMMMGA
FVLICGGMALAMWKLPGSFLPTEDQGEIMVQYTLPAGATAVRTAEVRRQVTDWFLTKEKA
NTDVIFTVDGFSFSGSGQNAGMAFVSLKNWSERKGEENTAQAIALRATKELGSIRDATLF
AMTPPSVDGLGQSNGFTFELMASGGTDRDSLMKMRSQLLAAANQSTELQSVRANDLPQMP
QLQVDIDNNKAVSLGLSLSDVTDTLSSAWGGTYVNDFIDRGRVKKVYIQGESDARAVPSD
LGKWFVRGSDDSMTPFSAFATTRWQYGPESLVRYNGSAAFEIQGENASGFSSGAAMDKME
ALANDLPAGTTWAWSGMSLQEKLASGQAMSLYAISILVVFLCLAALYESWSVPFSVIMVI
PLGLLGAALAAWMRGLSNDVYFQVALLTTIGLSSKNAILIVEFAESAVEEGYSLSRAAMR
AAQTRLRPIVMTSLAFIAGVLPLAIATGAGANSRVAIGTGIIGGTLTATLLAVFFVPLFF
VLVKRFFTRHRSSQE