Protein Info for BWI76_RS27625 in Klebsiella michiganensis M5al

Annotation: NADPH:quinone reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 335 TIGR02817: zinc-binding alcohol dehydrogenase family protein" amino acids 12 to 335 (324 residues), 521.1 bits, see alignment E=7.3e-161 PF08240: ADH_N" amino acids 32 to 113 (82 residues), 50.1 bits, see alignment E=4.3e-17 PF00107: ADH_zinc_N" amino acids 159 to 265 (107 residues), 44.2 bits, see alignment E=2.7e-15 PF13602: ADH_zinc_N_2" amino acids 193 to 332 (140 residues), 56.6 bits, see alignment E=8.3e-19

Best Hits

KEGG orthology group: None (inferred from 89% identity to eae:EAE_06665)

Predicted SEED Role

"Bifunctional protein: zinc-containing alcohol dehydrogenase; quinone oxidoreductase ( NADPH:quinone reductase) (EC 1.1.1.-); Similar to arginate lyase" (EC 1.1.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.-

Use Curated BLAST to search for 1.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285BBK2 at UniProt or InterPro

Protein Sequence (335 amino acids)

>BWI76_RS27625 NADPH:quinone reductase (Klebsiella michiganensis M5al)
MKAIAITRAATEGSNIPFLTDIELPQPVAEGHDLLVEVKAISVNPVDTKVRAGFNADTPR
VLGWDAVGVVKAVGSAVTLFAAGDEVWYAGALGRPGSNSEFQLVDERIVARKPRSLDNAS
AAALPLTTITAWELLFHRLGVEEGGNAGDTLLIVGAAGGVGSILTQLASKLTGMTVIGTA
SRAESQKWVREAGAHHVIDHSKPLADELARIGVKAVTHVASLTNTDQHYPQLIAALAPQG
KLALIDDPETLDVVPLKAKSISLHWEFMFTRSMFATPDMIAQHQLLTRVAALIDDNTIKT
TLGVHYGAITAANLQKAHAQLETGRSVGKIVLEGF