Protein Info for BWI76_RS27585 in Klebsiella michiganensis M5al

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 523 transmembrane" amino acids 226 to 241 (16 residues), see Phobius details PF08280: HTH_Mga" amino acids 6 to 49 (44 residues), 23.6 bits, see alignment 1.2e-08 PF08220: HTH_DeoR" amino acids 7 to 47 (41 residues), 26.3 bits, see alignment 1.5e-09 PF08279: HTH_11" amino acids 7 to 64 (58 residues), 37.5 bits, see alignment 5.3e-13 PF05043: Mga" amino acids 10 to 59 (50 residues), 22.6 bits, see alignment 4e-08 amino acids 92 to 169 (78 residues), 29.2 bits, see alignment E=3.5e-10 PF00874: PRD" amino acids 209 to 294 (86 residues), 44.5 bits, see alignment E=4.7e-15 amino acids 323 to 413 (91 residues), 58.4 bits, see alignment E=2.1e-19

Best Hits

KEGG orthology group: K02538, activator of the mannose operon, transcriptional antiterminator (inferred from 72% identity to ect:ECIAI39_4185)

Predicted SEED Role

"Transcriptional antiterminator of lichenan operon, BglG family" in subsystem Beta-Glucoside Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285BBS2 at UniProt or InterPro

Protein Sequence (523 amino acids)

>BWI76_RS27585 hypothetical protein (Klebsiella michiganensis M5al)
MQMITSRQNRLLKFLLPRREYVTLMKIAEYLNVSEKTVQRDLRFLEQWLSEWKMTINKRS
GAGVMLIADNVTDLLQLDQLLGNEGEDSDVMMNNSRRVKIASQLLSETPRETSINKLSER
YFISSASIVNDLKIIESWITPLGLTLIRSQSGTHIEGSENSVRQAMASLINGVINHNEPG
CIIHSRLDSGSYKALVHYFGEDDVLFVQSLLQEMERKLCWSLGEPYYVNIFTHILIMMYR
ITRGNALPRREQGQQIFDETIFSVAQNMLRKIELRIDHSLPEDEVWFIYQYIISSGVMVE
ERDDVSMARYMHSSDEARQITSRLISVFSTMIDIDLTADRALYDGLLIHIKPLINRLNFR
IYIRNPLLEDIKGELTDVWPLTQRAVNQVFSGWGECAVSDDEVGYLTVHFQAAMERQVAS
KRVLLVCSTGIGTSHLLKSRVLRAFPDWTIVGVVSASSLHTLQPQDKIELVISTINLPEI
ALPVVYVSAFFNDADIRRVTEKIITDKLHRAAISAVDNEVLYP