Protein Info for BWI76_RS27435 in Klebsiella michiganensis M5al

Annotation: tRNA (guanosine(18)-2'-O)-methyltransferase TrmH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 229 PF00588: SpoU_methylase" amino acids 20 to 159 (140 residues), 135.6 bits, see alignment E=1.4e-43 PF12105: SpoU_methylas_C" amino acids 163 to 218 (56 residues), 83.9 bits, see alignment E=5e-28

Best Hits

Swiss-Prot: 92% identical to TRMH_ECO57: tRNA (guanosine(18)-2'-O)-methyltransferase (trmH) from Escherichia coli O157:H7

KEGG orthology group: K00556, tRNA (guanosine-2'-O-)-methyltransferase [EC: 2.1.1.34] (inferred from 93% identity to cko:CKO_05108)

MetaCyc: 92% identical to tRNA (Gm18) 2'-O-methyltransferase (Escherichia coli K-12 substr. MG1655)
tRNA guanosine-2'-O-methyltransferase. [EC: 2.1.1.34]

Predicted SEED Role

"tRNA (guanosine(18)-2'-O)-methyltransferase (EC 2.1.1.34)" (EC 2.1.1.34)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.34

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285BBP1 at UniProt or InterPro

Protein Sequence (229 amino acids)

>BWI76_RS27435 tRNA (guanosine(18)-2'-O)-methyltransferase TrmH (Klebsiella michiganensis M5al)
MNSQRYARICEMLARRQPDLTVCMEQVHKPHNVSAVIRTADAVGVHEVHAIWPGSHMRTM
ASAAAGSNSWVQVKTHRTIGEAVTHLKGQGMQILATHLSDKAVDFREIDYTRPTCILMGQ
EKTGITQEALDLADQDIIIPMTGMVQSLNVSVASALILYEAQRQRQNAGMYQRENSMLPE
EDQQRLLFEGGYPVLARVAKRKGLPYPHVNEQGEVEADAAWWATMQAAK