Protein Info for BWI76_RS27405 in Klebsiella michiganensis M5al

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 205 transmembrane" amino acids 6 to 23 (18 residues), see Phobius details amino acids 30 to 50 (21 residues), see Phobius details amino acids 64 to 81 (18 residues), see Phobius details amino acids 88 to 109 (22 residues), see Phobius details amino acids 115 to 136 (22 residues), see Phobius details amino acids 148 to 166 (19 residues), see Phobius details amino acids 172 to 191 (20 residues), see Phobius details PF03458: Gly_transporter" amino acids 5 to 78 (74 residues), 78.1 bits, see alignment E=1.9e-26 amino acids 91 to 164 (74 residues), 77.7 bits, see alignment E=2.5e-26

Best Hits

Swiss-Prot: 88% identical to YICG_ECOL6: UPF0126 inner membrane protein YicG (yicG) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: None (inferred from 94% identity to kpe:KPK_0102)

Predicted SEED Role

"Putative inner membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285BBG3 at UniProt or InterPro

Protein Sequence (205 amino acids)

>BWI76_RS27405 membrane protein (Klebsiella michiganensis M5al)
MLLHILYLIGITAEAMTGALAAGRRRMDTFGVIIIATATALGGGSVRDILLGHYPLGWVQ
HPEYVIIVAVAAVLTTIAAPVMPHLRRLFLVLDALGLIVFSIIGAQIALDMGQGPVIASI
AAVITGVFGGVLRDMFCKRIPLVFQKELYAGVSFAAAVLYIALQHYVSNHDVVVISTLLF
GFTARMLALRWKLGLPVFNYNHSAH