Protein Info for BWI76_RS26810 in Klebsiella michiganensis M5al

Annotation: cellulose biosynthesis protein BcsG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 558 transmembrane" amino acids 25 to 55 (31 residues), see Phobius details amino acids 67 to 84 (18 residues), see Phobius details amino acids 112 to 131 (20 residues), see Phobius details amino acids 138 to 160 (23 residues), see Phobius details TIGR03368: cellulose synthase operon protein YhjU" amino acids 22 to 556 (535 residues), 757.1 bits, see alignment E=4.2e-232 PF11658: CBP_BcsG" amino acids 23 to 553 (531 residues), 742 bits, see alignment E=1.7e-227

Best Hits

Swiss-Prot: 73% identical to BCSG_ECOLI: Cellulose biosynthesis protein BcsG (bcsG) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 87% identity to eae:EAE_05950)

MetaCyc: 73% identical to cellulose phosphoethanolamine transferase (Escherichia coli K-12 substr. MG1655)
2.7.8.-

Predicted SEED Role

"FIG002337: predicted inner membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285BBC1 at UniProt or InterPro

Protein Sequence (558 amino acids)

>BWI76_RS26810 cellulose biosynthesis protein BcsG (Klebsiella michiganensis M5al)
MTKPKTPTASLPLWRYWRGLSGWNFYFLVKFALLWAGYLNFHPMLNLVFLAFLLVPIPQY
KLHRIRHWIAIPLGFMLFWHDTWLPGPESIASQGSQIAGFSADYIWDLVTRFINWNMVGA
FFVLLVLWLFISQWLRVTVFVSAIMVWLVVSPLLPSFTLWPAGQPTAAAANTAANTTGGT
AIATNTAPANNDIPPQTEPPTSANLTNWLNAFYASEQKRKTTFPDALPADAQPFDVLIIN
ICSLSWSDIESAGLTDHPLWKHFDLLFKNFNSATSYSGPAAARLLRASCGQLSHANLYQP
SGSECYLFENLAKLGFTQQLMLGHNGIFGDFLKELRSLGGIQSPLMDQSGLPVILQGFDG
SPVYDDQATLNRWLQTLDKLNTPRTATFYNTLPLHDGNHYPGQSKTADYKARAQKFFDEL
DSFFTELEKSGRKVLVIVVPEHGAALKGDKMQVSGLRDIPSPSITNVPAAVKFFGIKAQH
PDAPIIINQPSSYLAISELVVRALDGKMFDENDINWQQYIANLPQSAAVSENSNAIVIQY
QGKPYVQLNGGSWVPYPQ