Protein Info for BWI76_RS26730 in Klebsiella michiganensis M5al

Annotation: inner membrane protein YhjD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 343 transmembrane" amino acids 78 to 103 (26 residues), see Phobius details amino acids 141 to 160 (20 residues), see Phobius details amino acids 192 to 214 (23 residues), see Phobius details amino acids 234 to 256 (23 residues), see Phobius details amino acids 268 to 289 (22 residues), see Phobius details amino acids 302 to 327 (26 residues), see Phobius details TIGR00766: inner membrane protein YhjD" amino acids 58 to 332 (275 residues), 422.4 bits, see alignment E=3.1e-131 PF03631: Virul_fac_BrkB" amino acids 72 to 331 (260 residues), 155.8 bits, see alignment E=8.4e-50

Best Hits

Swiss-Prot: 80% identical to YHJD_ECOLI: Inner membrane protein YhjD (yhjD) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 91% identity to eae:EAE_05875)

Predicted SEED Role

"Inner membrane protein YhjD"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285BBG8 at UniProt or InterPro

Protein Sequence (343 amino acids)

>BWI76_RS26730 inner membrane protein YhjD (Klebsiella michiganensis M5al)
MTPENDAQRPTEDPGQQPDKNKSAMAAINDSTVAKKANQALKSVTGTAEKVQRNHMVAHI
IRAAERFNDRLGNQFGAAITYFSFLSMIPILMVSFAAAGFVLASHPTLLQDIFDKILLNV
SDPTLAATLKNTINTAVQQRTAVGIVGLLVALYSGINWMGNLREAIRAQSRDVWERTPQD
QEKIWVKYFRDFISLIGLLVALVITLSITSIAGSAQQMIISALYLDYIEWLKPAWRLIGL
AISIFANYLLFFWIFWRLPRHRPRRKALIRGTLIAAVGFEIIKIIMTWTLPALVKSPSGA
AFGSVLGIMAFFYFFARLTLFCAAWIATAEYKDDRRMPGKAHD