Protein Info for BWI76_RS26625 in Klebsiella michiganensis M5al

Annotation: gluconate transporter periplasmic gluconate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 224 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details PF00156: Pribosyltran" amino acids 142 to 222 (81 residues), 31.9 bits, see alignment E=3.9e-12

Best Hits

Swiss-Prot: 72% identical to GNTX_SALTI: DNA utilization protein YhgH (gntX) from Salmonella typhi

KEGG orthology group: None (inferred from 80% identity to eae:EAE_05325)

Predicted SEED Role

"Competence protein F homolog, phosphoribosyltransferase domain; protein YhgH required for utilization of DNA as sole source of carbon and energy"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285BAZ9 at UniProt or InterPro

Protein Sequence (224 amino acids)

>BWI76_RS26625 gluconate transporter periplasmic gluconate-binding protein (Klebsiella michiganensis M5al)
MLTAHSLCWLCQMPLAIARWGICSRCASALLDSEPLCPQCGLPARSDALPCGRCLQKPPP
WQRLVAVNDYRPPLSGLIHQLKFTQRPELAPALARLLLLRIRQRRDLPRPDRIISVPLWQ
RRQWKRGFNQSDLLCRPLSRWLGCAWRSDALTRRRRTATQHQLSARLRKQNLKNAFQLEL
SLQGHHIAIVDDVVTTGSTVAEISRLLLRNGAATVQVWCICRTL