Protein Info for BWI76_RS26490 in Klebsiella michiganensis M5al

Annotation: phenolic acid decarboxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 167 PF05870: PA_decarbox" amino acids 9 to 164 (156 residues), 286.1 bits, see alignment E=3e-90

Best Hits

Swiss-Prot: 61% identical to PADC_VIBCH: Probable phenolic acid decarboxylase (padC) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: None (inferred from 95% identity to eae:EAE_05705)

Predicted SEED Role

"Phenolic acid decarboxylase (EC 4.1.1.-)" (EC 4.1.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.1.1.-

Use Curated BLAST to search for 4.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285BAX9 at UniProt or InterPro

Protein Sequence (167 amino acids)

>BWI76_RS26490 phenolic acid decarboxylase (Klebsiella michiganensis M5al)
MSTFDKHDLSGFIGKHLVYTYDNGWNYEIYVKNGTTLDYRIHSGIVANRWVKDQHAYIVR
VGESIYKISWTEPTGTDVSLIVNLGDKLFHGTIFFPRWVMNNPEKTVCFQNDHIPLMVSY
REAGPAYPTEVIDEFATITFVRDCGADNDEVINCPANELPDNFPGNL