Protein Info for BWI76_RS26390 in Klebsiella michiganensis M5al

Annotation: cell division protein FtsX

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 352 transmembrane" amino acids 72 to 95 (24 residues), see Phobius details amino acids 220 to 244 (25 residues), see Phobius details amino acids 269 to 291 (23 residues), see Phobius details amino acids 323 to 343 (21 residues), see Phobius details TIGR00439: putative protein insertion permease FtsX" amino acids 47 to 352 (306 residues), 491.6 bits, see alignment E=4.5e-152 PF18075: FtsX_ECD" amino acids 110 to 204 (95 residues), 57.3 bits, see alignment E=2e-19 PF02687: FtsX" amino acids 227 to 341 (115 residues), 49 bits, see alignment E=5.9e-17

Best Hits

Swiss-Prot: 83% identical to FTSX_ECOLI: Cell division protein FtsX (ftsX) from Escherichia coli (strain K12)

KEGG orthology group: K09811, cell division transport system permease protein (inferred from 94% identity to kva:Kvar_0273)

Predicted SEED Role

"Cell division protein FtsX" in subsystem Bacterial Cell Division

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285BB99 at UniProt or InterPro

Protein Sequence (352 amino acids)

>BWI76_RS26390 cell division protein FtsX (Klebsiella michiganensis M5al)
MNKREAMNHIRRFGNRFDRFRNAGGAGGSGGRNASKRPKAAPNPASRKSNVFNEQVRYAW
HGAIQDLKSTPLATFLTVMVIAISLTLPSVCYMVYKNVSTAASQYYPTPQITVYLEKTLD
DDAAARVVGQLQAEQGVEKVNYLSRDEALGEFRNWSGFGGALDMLEENPLPAVAIVVPKI
DFQSVEALNTLRDRVSHVQGVDEVRMDDSWFARLSSLTGLVGRVSAMIGVLMVAAVFLVI
GNSVRLSIFARRDTINVQKLIGATDGFILRPFLYGGALLGFSGAFLSLILSEIMVMRLSS
AVTEVAKVFGTQFELSGLGFDECLLMLIVCSMIGWVAAWLATVQHLRHFTPE