Protein Info for BWI76_RS26300 in Klebsiella michiganensis M5al

Annotation: glycerol-3-phosphate transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 295 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 78 to 100 (23 residues), see Phobius details amino acids 111 to 130 (20 residues), see Phobius details amino acids 157 to 181 (25 residues), see Phobius details amino acids 206 to 228 (23 residues), see Phobius details amino acids 267 to 287 (21 residues), see Phobius details PF00528: BPD_transp_1" amino acids 86 to 293 (208 residues), 69.9 bits, see alignment E=1.2e-23

Best Hits

Swiss-Prot: 94% identical to UGPA_SALTY: sn-glycerol-3-phosphate transport system permease protein UgpA (ugpA) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K05814, sn-glycerol 3-phosphate transport system permease protein (inferred from 96% identity to kpu:KP1_5146)

MetaCyc: 92% identical to sn-glycerol 3-phosphate ABC transporter membrane subunit UgpA (Escherichia coli K-12 substr. MG1655)
ABC-34-RXN [EC: 7.6.2.10]; 7.6.2.10 [EC: 7.6.2.10]

Predicted SEED Role

"Glycerol-3-phosphate ABC transporter, permease protein UgpA (TC 3.A.1.1.3)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization (TC 3.A.1.1.3)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285BAU5 at UniProt or InterPro

Protein Sequence (295 amino acids)

>BWI76_RS26300 glycerol-3-phosphate transporter permease (Klebsiella michiganensis M5al)
MSSSRPVFRSRWLPYLLVAPQLVITVIFFIWPAGEALWYSLQSVDPFGLSSQFVGLDNFL
ALFQDPYYLDSFWTTIKFSTMVTVSGLLISLFFAALVDYVVRGSRFYQTLMLLPYAVAPA
VAAVLWIFLFNPGRGLITHLLGEMGYDWNHAQNSGQAMFLVVFASVWKQISYNFLFFFAA
LQSIPRSLVEAAAIDGAGPVRRFFRLALPLIAPVSFFLLVVNLVYAFFDTFPVIDAATGG
GPVQATTTLIYKIYREGFAGLDLSASAAQSVVLMFLVIILTVVQFRYVERKVRYQ