Protein Info for BWI76_RS26220 in Klebsiella michiganensis M5al

Annotation: aspartate-semialdehyde dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 368 TIGR01745: aspartate-semialdehyde dehydrogenase" amino acids 2 to 367 (366 residues), 722.2 bits, see alignment E=5.5e-222 PF01118: Semialdhyde_dh" amino acids 3 to 120 (118 residues), 86.3 bits, see alignment E=2.1e-28 PF02774: Semialdhyde_dhC" amino acids 145 to 354 (210 residues), 180.7 bits, see alignment E=3.4e-57

Best Hits

Swiss-Prot: 93% identical to DHAS_ECOL6: Aspartate-semialdehyde dehydrogenase (asd) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: None (inferred from 96% identity to eae:EAE_05400)

MetaCyc: 93% identical to aspartate-semialdehyde dehydrogenase (Escherichia coli K-12 substr. MG1655)
Aspartate-semialdehyde dehydrogenase. [EC: 1.2.1.11]

Predicted SEED Role

"Aspartate-semialdehyde dehydrogenase (EC 1.2.1.11)" in subsystem Lysine Biosynthesis DAP Pathway or Threonine and Homoserine Biosynthesis (EC 1.2.1.11)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.2.1.11

Use Curated BLAST to search for 1.2.1.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285BB07 at UniProt or InterPro

Protein Sequence (368 amino acids)

>BWI76_RS26220 aspartate-semialdehyde dehydrogenase (Klebsiella michiganensis M5al)
MKNVGFIGWRGMVGSVLMQRMVEERDFDAIRPVFFSTSQLGQPAPSFGGSTGGTLQDAFD
LEALKALDIIVTCQGGDYTNDIYPKLRESGWQGYWIDAASSLRMKDDAIIILDPVNQDVI
TAGLNNGVKTFVGGNCTVSLMLMSLGGLFAQDLVEWVSVATYQAASGGGARHMRELLTQM
GQLHSHVAAELADPASAILEIERKVTSLTRSGELAVDNFGVPLAGSLIPWIDKQLDNGQS
REEWKGQAETNKILATASPIPVDGLCVRVGALRCHSQAFTIKLKKEVSIPTVEELLAAHN
PWAKVVPNDRDITMRELTPAAVTGTLTTPVGRLRKLNMGPEYLSAFTVGDQLLWGAAEPL
RRMLKQLA