Protein Info for BWI76_RS25835 in Klebsiella michiganensis M5al
Annotation: 50S ribosomal protein L4
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to RL4_ENT38: 50S ribosomal protein L4 (rplD) from Enterobacter sp. (strain 638)
KEGG orthology group: K02926, large subunit ribosomal protein L4 (inferred from 100% identity to eco:b3319)MetaCyc: 100% identical to 50S ribosomal subunit protein L4 (Escherichia coli K-12 substr. MG1655)
Predicted SEED Role
"LSU ribosomal protein L4p (L1e)" in subsystem Ribosome LSU bacterial
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A285BAZ1 at UniProt or InterPro
Protein Sequence (201 amino acids)
>BWI76_RS25835 50S ribosomal protein L4 (Klebsiella michiganensis M5al) MELVLKDAQSALTVSETTFGRDFNEALVHQVVVAYAAGARQGTRAQKTRAEVTGSGKKPW RQKGTGRARSGSIKSPIWRSGGVTFAARPQDHSQKVNKKMYRGALKSILSELVRQDRLIV VESFSVEAPKTKLLAQKLKDMALEDVLIITGELDENLFLAARNLHKVDVRDATGIDPVSL IAFDKVVMTADAVKQVEEMLA