Protein Info for BWI76_RS25790 in Klebsiella michiganensis M5al

Annotation: 50S ribosomal protein L14

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 123 PF00238: Ribosomal_L14" amino acids 1 to 123 (123 residues), 186 bits, see alignment E=1e-59 TIGR01067: ribosomal protein uL14" amino acids 1 to 123 (123 residues), 198.9 bits, see alignment E=9.9e-64

Best Hits

Swiss-Prot: 100% identical to RL14_SALSV: 50S ribosomal protein L14 (rplN) from Salmonella schwarzengrund (strain CVM19633)

KEGG orthology group: K02874, large subunit ribosomal protein L14 (inferred from 99% identity to ypp:YPDSF_0143)

MetaCyc: 98% identical to 50S ribosomal subunit protein L14 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"LSU ribosomal protein L14p (L23e)" in subsystem Ribosome LSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285BAY1 at UniProt or InterPro

Protein Sequence (123 amino acids)

>BWI76_RS25790 50S ribosomal protein L14 (Klebsiella michiganensis M5al)
MIQEQTMLNVADNSGARRVMCIKVLGGSHRRYAGVGDIIKITIKEAIPRGKVKKGDVLKA
VVVRTKKGVRRPDGSVIRFDGNACVILNNNSEQPIGTRIFGPVTRELRNEKFMKIISLAP
EVL