Protein Info for BWI76_RS25690 in Klebsiella michiganensis M5al

Annotation: large-conductance mechanosensitive channel

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 137 transmembrane" amino acids 16 to 40 (25 residues), see Phobius details amino acids 75 to 96 (22 residues), see Phobius details PF01741: MscL" amino acids 3 to 131 (129 residues), 162.1 bits, see alignment E=3.7e-52 TIGR00220: large conductance mechanosensitive channel protein" amino acids 3 to 133 (131 residues), 197 bits, see alignment E=5.5e-63

Best Hits

Swiss-Prot: 98% identical to MSCL_KLEP7: Large-conductance mechanosensitive channel (mscL) from Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)

KEGG orthology group: K03282, large conductance mechanosensitive channel (inferred from 98% identity to kpe:KPK_0425)

MetaCyc: 93% identical to large conductance mechanosensitive channel (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-86

Predicted SEED Role

"Large-conductance mechanosensitive channel" in subsystem Potassium homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285BAN3 at UniProt or InterPro

Protein Sequence (137 amino acids)

>BWI76_RS25690 large-conductance mechanosensitive channel (Klebsiella michiganensis M5al)
MSFLKEFREFAMRGNVVDLAVGVIIGAAFGKIVSSLVADIIMPPLGLLIGGIDFKQFAVT
LRDAQGDIPAVVMHYGVFIQNVFDFIIVAFAIFMAIKLMNKLNRKKEETPAAPPAPTKEE
VLLSEIRDLLKEQNNRS