Protein Info for BWI76_RS25645 in Klebsiella michiganensis M5al

Annotation: shikimate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 272 TIGR00507: shikimate dehydrogenase" amino acids 3 to 270 (268 residues), 328 bits, see alignment E=1.9e-102 PF08501: Shikimate_dh_N" amino acids 6 to 88 (83 residues), 82 bits, see alignment E=4.4e-27 PF01488: Shikimate_DH" amino acids 121 to 190 (70 residues), 34.2 bits, see alignment E=3.7e-12 PF18317: SDH_C" amino acids 237 to 267 (31 residues), 27.4 bits, see alignment 3.4e-10

Best Hits

Swiss-Prot: 80% identical to AROE_CITK8: Shikimate dehydrogenase (NADP(+)) (aroE) from Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)

KEGG orthology group: None (inferred from 86% identity to eae:EAE_04760)

MetaCyc: 79% identical to shikimate dehydrogenase (Escherichia coli K-12 substr. MG1655)
Shikimate dehydrogenase. [EC: 1.1.1.25]

Predicted SEED Role

"Shikimate 5-dehydrogenase I alpha (EC 1.1.1.25)" in subsystem Chorismate Synthesis or Common Pathway For Synthesis of Aromatic Compounds (DAHP synthase to chorismate) (EC 1.1.1.25)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.25

Use Curated BLAST to search for 1.1.1.25

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285BAC2 at UniProt or InterPro

Protein Sequence (272 amino acids)

>BWI76_RS25645 shikimate dehydrogenase (Klebsiella michiganensis M5al)
METYAVFGNPIAHSKSPSIHRLFAQQLQITHPYGRILAPLDDFVTTLDAFFNEGGKGANV
TVPFKEEAFARADELTERAALAGAVNTLKRLEDGRLLGDNTDGIGLLSDLERLGFIKPGF
RVLLIGAGGASRGVLLPLLSLDCAVTIVNRTYSRAHELATLFSHTGSVRALDIEALGGQE
FDLIVNATSSGIDGDVPSIPVTLINPHVCCYDMFYQKGCTPFLALCQQHGATKCADGLGM
LVAQAAHAVLLWHGVLPEIRPVIAALQKELNA