Protein Info for BWI76_RS25505 in Klebsiella michiganensis M5al

Annotation: RNase E specificity factor CsrD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 646 transmembrane" amino acids 7 to 31 (25 residues), see Phobius details amino acids 135 to 155 (21 residues), see Phobius details amino acids 538 to 558 (21 residues), see Phobius details PF17157: GAPES4" amino acids 34 to 130 (97 residues), 106 bits, see alignment E=1.7e-34 PF00990: GGDEF" amino acids 225 to 380 (156 residues), 91.2 bits, see alignment E=9.4e-30 PF00563: EAL" amino acids 403 to 628 (226 residues), 121.1 bits, see alignment E=7.8e-39

Best Hits

Swiss-Prot: 75% identical to CSRD_ECOLI: RNase E specificity factor CsrD (csrD) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 90% identity to kva:Kvar_0439)

Predicted SEED Role

"RNase E specificity factor CsrD"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285BAD3 at UniProt or InterPro

Protein Sequence (646 amino acids)

>BWI76_RS25505 RNase E specificity factor CsrD (Klebsiella michiganensis M5al)
MRLTTKFSAFVTLLTGLTIFVTLIGASLSFYNGIQLKMTNRVQAVATMLDNRLVSMSFDQ
IEPQMDELMTPVEAVRVDFQLNGKSVYSHSRTDNYRPLGSSKQFRAITVPSLKHPGMAIH
LVYLDPMANYFRSLHVTAPLSIAIGFMVLIIFFSVRWIRRQLAGQELLELRTARILNGER
GPQVRGSVHEWPANTSSALDMLLSELQFASDQRSRMDTLIRSYVAQDSKTGLSNRLFFDN
QLSTLLEDQEKVGSYGIVMMIRLPDFDLLRDNWGRAATEEHYFTLINMLSTFIMRYPGAL
LARYHRSDFAVLLPHRTLKEADSIAGLLLKAMDALPPTRILDRDDMMHIGICAFRSGQTA
AQVMEHAEAATRNAVLQGSNSWAVYDDSLPEKGRGNVRWRTLIEQMLSRGGPRLYQKPAV
TRDGRVHHRELMCRLYDGKEEVIAAEYMPMVLQFGLAEEYDRLQITRLLPFLGFWPEENL
ALQVTVESLIRPRFQRWLRDTLMQCEKSHRRRIIFELAEADVCQYIGRLQPVMRLVNALG
IRIAVVQAGLTLVGTSWIKQLDVEVIKLHSGLSRNIEKRSENQLLVQSLVEACKGMPVQV
FATGVLSRSEWQVLSQCGVTGGQGEFFAASQPLDTNVKKYSQRYSV