Protein Info for BWI76_RS25395 in Klebsiella michiganensis M5al

Annotation: L(+)-tartrate dehydratase subunit beta

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 205 PF05683: Fumerase_C" amino acids 6 to 181 (176 residues), 131.7 bits, see alignment E=1.2e-42 TIGR00723: hydrolyase, tartrate beta subunit/fumarate domain protein, Fe-S type" amino acids 13 to 181 (169 residues), 218.8 bits, see alignment E=2.3e-69

Best Hits

Swiss-Prot: 70% identical to TTDB_ECOL5: L(+)-tartrate dehydratase subunit beta (ttdB) from Escherichia coli O6:K15:H31 (strain 536 / UPEC)

KEGG orthology group: K03780, L(+)-tartrate dehydratase beta subunit [EC: 4.2.1.32] (inferred from 100% identity to set:SEN3187)

MetaCyc: 70% identical to L(+)-tartrate dehydratase subunit beta (Escherichia coli K-12 substr. MG1655)
L(+)-tartrate dehydratase. [EC: 4.2.1.32]

Predicted SEED Role

"L(+)-tartrate dehydratase beta subunit (EC 4.2.1.32)" (EC 4.2.1.32)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.32

Use Curated BLAST to search for 4.2.1.32

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285BAJ1 at UniProt or InterPro

Protein Sequence (205 amino acids)

>BWI76_RS25395 L(+)-tartrate dehydratase subunit beta (Klebsiella michiganensis M5al)
MTKKILTTPIKDEDLADIKAGDIIYLNGHIVTCRDVAHRRLIEGGRELPVDVRGGAILHA
GPIVRPIKGEDDKFEMVSVGPTTSMRMEKFEKEFIAQTGVKLIVGKGGMGKGTEEGCAEH
KALHCVFPAGCAVVAAVCVEEIEDAQWRDLGMPETLWVCRVKEFGPLIVSIDTHGNNLFE
QNKIIFNQRKEIVADEICQNVSFIK