Protein Info for BWI76_RS25280 in Klebsiella michiganensis M5al

Annotation: RNase adaptor protein RapZ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 284 PF03668: ATP_bind_2" amino acids 1 to 282 (282 residues), 485 bits, see alignment E=3.6e-150

Best Hits

Swiss-Prot: 100% identical to RAPZ_KLEOX: RNase adapter protein RapZ (rapZ) from Klebsiella oxytoca

KEGG orthology group: K06958, UPF0042 nucleotide-binding protein (inferred from 98% identity to ecq:ECED1_3863)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285BAF6 at UniProt or InterPro

Protein Sequence (284 amino acids)

>BWI76_RS25280 RNase adaptor protein RapZ (Klebsiella michiganensis M5al)
MVLMIVSGRSGSGKSVALRALEDMGFYCVDNLPVVLLPELARSLADRNISAAVSIDVRNM
PESPEIFEQAMKNLPAEFSPQLLFLDADRNTLIRRYSDTRRLHPLSSKNLSLESAIDEES
DLLEPLRSRADLIVDTSEMSVHELAEMLRTRLLGKRERELTMVFESFGFKHGIPIDADYV
FDVRFLPNPHWDPKLRPMTGLDKPVAAFLDRHTEVHNFIYQTRSYLELWLPMLETNNRSY
LTVAIGCTGGKHRSVYIAEQLADYFRSRGKNVQSRHRTLEKRKS