Protein Info for BWI76_RS25240 in Klebsiella michiganensis M5al

Annotation: D-arabinose 5-phosphate isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 328 PF01380: SIS" amino acids 46 to 177 (132 residues), 114.4 bits, see alignment E=3.4e-37 TIGR00393: sugar isomerase, KpsF/GutQ family" amino acids 50 to 318 (269 residues), 410.8 bits, see alignment E=1.4e-127 PF00571: CBS" amino acids 206 to 262 (57 residues), 27.1 bits, see alignment E=4.2e-10 amino acids 273 to 325 (53 residues), 35.6 bits, see alignment 9.3e-13

Best Hits

Swiss-Prot: 85% identical to KDSD_SALTY: Arabinose 5-phosphate isomerase KdsD (kdsD) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K06041, arabinose-5-phosphate isomerase [EC: 5.3.1.13] (inferred from 94% identity to kpu:KP1_4919)

MetaCyc: 83% identical to D-arabinose 5-phosphate isomerase KdsD (Escherichia coli K-12 substr. MG1655)
Arabinose-5-phosphate isomerase. [EC: 5.3.1.13]

Predicted SEED Role

"Arabinose 5-phosphate isomerase (EC 5.3.1.13)" in subsystem KDO2-Lipid A biosynthesis (EC 5.3.1.13)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 5.3.1.13

Use Curated BLAST to search for 5.3.1.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285BAG1 at UniProt or InterPro

Protein Sequence (328 amino acids)

>BWI76_RS25240 D-arabinose 5-phosphate isomerase (Klebsiella michiganensis M5al)
MSQIDLPADFDFQRAGREVLDIEREGLAQLDQYINEDFTRACETIFRCTGKVVVMGMGKS
GHIGRKMAATFASTGTSSFFVHPGEAAHGDLGMVTPCDVVIALSNSGESNEILALIPVLK
RQQVSLICITSRPESSMARAADIHLCVKVPKEACPLGLAPTSSTTAALVMGDALAVALLE
ARGFTAEDFALSHPGGALGRKLLLRVNDIMHTGDEIPHVGLEATLRDALLEITRKNLGMT
AICDDEMNIIGIFTDGDLRRVFDTGIDMRNASIAEVMTRGGIRIRPGTLAVDALNLMQSR
HITCVLVADGDRLVGVIHMHDLLRAGVV