Protein Info for BWI76_RS25115 in Klebsiella michiganensis M5al

Annotation: argininosuccinate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00032: argininosuccinate synthase
  • amino acids 13 to 419 (407 residues), 552.1 bits, E=4.4e-170
• PF00764: Arginosuc_synth
  • amino acids 14 to 160 (147 residues), 67.1 bits, E=2e-22
• PF20979: Arginosuc_syn_C
  • amino acids 191 to 407 (217 residues), 105.2 bits, E=4e-34

Best Hits

Swiss-Prot: 97% identical to ASSY_KLEP7: Argininosuccinate synthase (argG) from Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)

KEGG orthology group: K01940, argininosuccinate synthase [EC: 6.3.4.5] (inferred from 97% identity to kpe:KPK_0542)

Predicted SEED Role

"Argininosuccinate synthase (EC 6.3.4.5)" in subsystem Arginine Biosynthesis extended (EC 6.3.4.5)

MetaCyc Pathways

• superpathway of arginine and polyamine biosynthesis (16/17 steps found)
• L-arginine biosynthesis I (via L-ornithine) (9/9 steps found)
• L-arginine biosynthesis II (acetyl cycle) (9/10 steps found)
• L-arginine biosynthesis III (via N-acetyl-L-citrulline) (8/9 steps found)
• nitric oxide biosynthesis II (mammals) (2/3 steps found)
• urea cycle (3/5 steps found)
• superpathway of L-citrulline metabolism (8/12 steps found)
• canavanine biosynthesis (2/4 steps found)
• L-arginine biosynthesis IV (archaea) (4/9 steps found)

KEGG Metabolic Maps

• Alanine and aspartate metabolism
• Arginine and proline metabolism
• Urea cycle and metabolism of amino groups

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.4.5

Sequence Analysis Tools

See A0A285BA60 at UniProt or InterPro

Protein Sequence (447 amino acids)

>BWI76_RS25115 argininosuccinate synthase (Klebsiella michiganensis M5al)
MTTILKHLPVGQRIGIAFSGGLDTSAALLWMRKKGAVPYAYTANLGQPDEDDYDAIPRRA
KEYGAEGARLIDCRKQLVAEGIAAIQCGAFHNTTGGLTYFNTTPLGRAVTGTMLVAAMKE
DGVNIWGDGSTYKGNDIERFYRYGLLTNAELKIYKPWLDSDFIDELGGRQEMSEFMISCG
FDYKMSVEKAYSTDSNMLGATHEAKDLEFLNSSVKIVNPIMGVKFWDESVKIPAEEVTVR
FEQGHPVALNGQTFSDDVELMLEANRIGGRHGLGMSDQIENRIIEAKSRGIYEAPGMALL
HIAYERLLTGIHNEDTIEQYHAHGRQLGRLLYQGRWFDSQALMLRDGLQRWVASQITGEV
TLELRRGNDYSILNTVSDNLTYKAERLTMEKGDSMFSAEDRIGQLTMRNLDITDTRDKLF
GYAQSGLLTASSATGLPQVENLESKSK