Protein Info for BWI76_RS25095 in Klebsiella michiganensis M5al

Annotation: transcription termination protein NusA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 495 PF08529: NusA_N" amino acids 4 to 123 (120 residues), 133.7 bits, see alignment E=9.7e-43 TIGR01953: transcription termination factor NusA" amino acids 4 to 342 (339 residues), 428.8 bits, see alignment E=1.4e-132 PF00575: S1" amino acids 134 to 195 (62 residues), 23.5 bits, see alignment E=1.4e-08 PF13184: KH_NusA_1st" amino acids 199 to 276 (78 residues), 109.3 bits, see alignment E=2.1e-35 PF26594: KH_NusA_2nd" amino acids 280 to 343 (64 residues), 78.4 bits, see alignment E=7e-26 TIGR01954: transcription termination factor NusA, C-terminal duplication" amino acids 365 to 414 (50 residues), 69.7 bits, see alignment 1.7e-23 amino acids 440 to 489 (50 residues), 63.8 bits, see alignment 1.2e-21 PF14520: HHH_5" amino acids 432 to 486 (55 residues), 43.4 bits, see alignment 9.9e-15

Best Hits

Swiss-Prot: 95% identical to NUSA_ECOL6: Transcription termination/antitermination protein NusA (nusA) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: None (inferred from 98% identity to eae:EAE_04280)

Predicted SEED Role

"Transcription termination protein NusA" in subsystem NusA-TFII Cluster or Transcription factors bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285BA54 at UniProt or InterPro

Protein Sequence (495 amino acids)

>BWI76_RS25095 transcription termination protein NusA (Klebsiella michiganensis M5al)
MNKEILAVVEAVSNEKALPREKIFEALESALATATKKKYEQEIDVRVEIDRKSGDFDTFR
RWLVVEEVTQPTREITLEAARYEDESMNPGDYVEDQIESVTFDRITTQTAKQVIVQKVRE
AERAMVVDQFREHEGEIITGVVKKVNRDNITLDLGNNAEAVILREDMLPRENFRPGDRIR
GVLYAVRPEARGAQLFVTRSKPEMLVELFRIEVPEIGEEVLEIKAAARDPGSRAKIAVKT
NDKRIDPVGACVGMRGARVQAVSTELGGERIDIVLWDDNPAQFVINAMAPADVASIVVDE
DKHTMDIAVEAGNLAQAIGRNGQNVRLASQLSGWELNVMTVDDLQAKHQAEAHAAIDTFT
KYLDIDEDFATLLVEEGFATLEELAYVPMKELLEIDGLDEATVEALRERAKNALTTLALA
KEESLGDSKPADDLLNLEGMDRALAFTLAARGVCTLEDLAEQGIDDLADIEGLTDEKAGE
LIMAARNICWFGDEA