Protein Info for BWI76_RS25005 in Klebsiella michiganensis M5al

Annotation: biotin-independent malonate decarboxylase subunit beta

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 309 transmembrane" amino acids 146 to 165 (20 residues), see Phobius details TIGR03133: biotin-independent malonate decarboxylase, beta subunit" amino acids 6 to 282 (277 residues), 339.4 bits, see alignment E=7.3e-106 PF01039: Carboxyl_trans" amino acids 11 to 275 (265 residues), 63.9 bits, see alignment E=6e-22

Best Hits

Swiss-Prot: 61% identical to MADC_MALRU: Malonyl-S-ACP:biotin-protein carboxyltransferase MADC (madC) from Malonomonas rubra

KEGG orthology group: K13932, malonate decarboxylase beta subunit (inferred from 88% identity to efe:EFER_3130)

MetaCyc: 61% identical to malonyl-S-ACP:biotin-protein carboxyltransferase alpha subunit (Malonomonas rubra)
RXN-9774 [EC: 7.2.4.4]; Malonyl-S-ACP:biotin-protein carboxyltransferase. [EC: 7.2.4.4, 2.1.3.10]

Predicted SEED Role

"Malonate decarboxylase beta subunit" in subsystem Malonate decarboxylase

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.3.10 or 7.2.4.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285BAA5 at UniProt or InterPro

Protein Sequence (309 amino acids)

>BWI76_RS25005 biotin-independent malonate decarboxylase subunit beta (Klebsiella michiganensis M5al)
MSDLRFLEASARVRAEGLVDKGSFTELIGPAAKWISPHLPVLGEAVEFDDGVVTGIGLLS
QHPTIVISQEGRFIGGSVGEVGGAKMVGALMLADELAAQTNDPARRPIVLISFETGGVRL
HEANAGLLAHAECMDMLQILRGRVPVVALIGSKIGCFGGMGFVAAATDLIVMSESGRLGL
TGPEVIEQEMGRSEFDASDRALVFRTTGGKHKYIVGDCNYLIADSLAAFHQQASLIADLP
WPEIEAMRRIGSEAKVRAQMALTQKINELAPTDARDVWAAAGNSVPQSLVDMSLETFLSN
VQRLSVEEA