Protein Info for BWI76_RS24945 in Klebsiella michiganensis M5al

Annotation: glutamine amidotransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01965: DJ-1_PfpI
  • amino acids 3 to 168 (166 residues), 183.2 bits, E=1.8e-58
• TIGR01382: intracellular protease, PfpI family
  • amino acids 4 to 171 (168 residues), 216 bits, E=1.2e-68

Best Hits

Swiss-Prot: 88% identical to YHBO_ECOLI: Protein/nucleic acid deglycase 2 (yhbO) from Escherichia coli (strain K12)

KEGG orthology group: K05520, protease I [EC: 3.2.-.-] (inferred from 91% identity to kpe:KPK_0561)

MetaCyc: 88% identical to protein/nucleic acid deglycase 2 (Escherichia coli K-12 substr. MG1655)
GLYOXIII-RXN [EC: 4.2.1.130]; RXN-17632 [EC: 4.2.1.130, 3.5.1.124]

Predicted SEED Role

"General stress protein 18"

MetaCyc Pathways

• methylglyoxal degradation IX (1/1 steps found)

KEGG Metabolic Maps

• Glycosaminoglycan degradation

Isozymes

Compare fitness of predicted isozymes for: 3.2.-.-

Use Curated BLAST to search for 3.2.-.- or 3.5.1.124 or 4.2.1.130

Sequence Analysis Tools

See A0A285BAH8 at UniProt or InterPro

Protein Sequence (172 amino acids)

>BWI76_RS24945 glutamine amidotransferase (Klebsiella michiganensis M5al)
MSKKIAVLITNDFEDSEFTSPADAYRLAGHEVVTIEKQAGKKVKGKKGEAEVVIDKAIDD
VSPADFDALLLPGGYSPDSLRGDERFVTFTRDFVNSGKPVFAICHGPQLLISADVIRGRK
LTAVKPIIIDVKNAGGEFYDQEVVIDNEQLVTSRTPDDLPAFNREALRLLGA