Protein Info for BWI76_RS24935 in Klebsiella michiganensis M5al

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 346 transmembrane" amino acids 15 to 32 (18 residues), see Phobius details amino acids 70 to 94 (25 residues), see Phobius details amino acids 113 to 134 (22 residues), see Phobius details amino acids 146 to 167 (22 residues), see Phobius details amino acids 173 to 191 (19 residues), see Phobius details amino acids 228 to 250 (23 residues), see Phobius details amino acids 262 to 281 (20 residues), see Phobius details amino acids 290 to 313 (24 residues), see Phobius details amino acids 325 to 345 (21 residues), see Phobius details PF03773: ArsP_1" amino acids 24 to 149 (126 residues), 47.4 bits, see alignment E=8e-17 amino acids 74 to 340 (267 residues), 98.1 bits, see alignment E=2.7e-32

Best Hits

Swiss-Prot: 84% identical to YRAQ_ECOLI: UPF0718 protein YraQ (yraQ) from Escherichia coli (strain K12)

KEGG orthology group: K07089, (no description) (inferred from 92% identity to kva:Kvar_0538)

Predicted SEED Role

"FIG006303: protein yraQ"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285BA25 at UniProt or InterPro

Protein Sequence (346 amino acids)

>BWI76_RS24935 hypothetical protein (Klebsiella michiganensis M5al)
MAGQSSSQAAAPFQWWKPALFFLVVIVGLWFVKWQPYYGKAFTAAETHSIGKSILANGDA
NPLAAAWDYALVYFLAVWKAAVLGVLLGSLIQVLIPRDWLLRTLGQSRFRGTLLGAAFSL
PGMMCTCCAAPVAAGMRKQQVSMGGALAFWLGNPLLNPATLVFMGFVLGWQFALIRLLAG
LATVLVVATLVQKWVKEAATQPADVPELPAETAQGGFFSRWLRALWTLFWNTIPVYILAV
LVLGAARVWLFPHADGVVDNTLFWVIAMAIAGCLFVIPTAAEIPIVQTMMLAGMGVAPAL
ALLITLPAVSVPSLIMLRKAFPAKALWLTGGLVALCGAVAGGLALI